[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2eghA.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "1bdmA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "3dbhC.bssp"
#ERROR : Can't open dsspfile "2e37C.bssp"
#ERROR : Can't open dsspfile "2eezA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "3donA.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "1dj3A.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "2e6eB.bssp"
#ERROR : Can't open dsspfile "3dfzB.bssp"
#ERROR : Can't open dsspfile "1a4iB.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "2a92B.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "3d7lA.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "1a4iA.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "1cg4A.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "2c82A.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "2e6gA.bssp"
#ERROR : Can't open dsspfile "3c0bC.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "2e6gG.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "2e37A.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "2e6gB.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "1b0aA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3ckyB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "3d7lD.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "3bywA.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "2ef0A.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "2amfD.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "1ek6B.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "1buaA.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "3ckyA.bssp"
#ERROR : Can't open dsspfile "2eggB.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "3dbrG.bssp"
#ERROR : Can't open dsspfile "3e5mB.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3c85B.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "1arzB.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3c24B.bssp"
#ERROR : Can't open dsspfile "3dtdA.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "1dxyA.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "3d7lB.bssp"
#ERROR : Can't open dsspfile "3dnfB.bssp"
#ERROR : Can't open dsspfile "2ax3A.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "2aemA.bssp"
#ERROR : Can't open dsspfile "2aw5A.bssp"
#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "2aefA.bssp"
#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "2dbqA.bssp"
#ERROR : Can't open dsspfile "1bg6A.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"

## Summary of PDB Search
:274
    2e-39  26%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    3e-38  29%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    5e-35  19%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    1e-33  26%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    8e-28  25%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-27  10%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-26  27%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-26  23%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    6e-26  29%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    8e-26  23%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-25  26%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-25  10%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-25  13%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    4e-25  10%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    1e-24  26%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-24  27%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    6e-24  11%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    1e-23  16%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    1e-23  26%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-23  20%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-23  19%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    6e-23   9%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    8e-23  12%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-22  12%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-22   9%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-22  28%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    6e-22   8%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    4e-21  14%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    5e-21  14%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    9e-21  15%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-21  25%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-20  22%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-20  15%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-20  12%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    3e-20  25%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    4e-20  27%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    4e-20  12%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    1e-19  21%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    2e-19   5%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    3e-19   9%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    3e-19  27%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-19  13%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    5e-19  14%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    5e-19  27%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    6e-19  14%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    7e-19   9%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    1e-18  30%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    1e-18  11%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-18  12%  2eghA  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    2e-18  13%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-18  23%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    3e-18  24%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-18  29%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-18  17%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    5e-18  26%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-18  20%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-17  19%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-17  16%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-17  15%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-17   9%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-17  10%  3e6vA  [x.x.x] ARGINASE-1
    3e-17  18%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-17  14%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    1e-16   7%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-16   8%  1bdmA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-16  21%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    3e-16  12%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    3e-16  21%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-16   8%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    3e-16  22%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    4e-16  11%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    5e-16  25%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    8e-16  27%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-15  13%  1d0iA  [c.23.13] TYPE II 3-DEHYDROQUINATE HYDRATASE
    3e-15  27%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-15  13%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-15  27%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-15  13%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    7e-15   6%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-14  26%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-14  16%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-14  16%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-14  20%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    2e-14   8%  3dbhC  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    3e-14  17%  2e37C  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-14  13%  2eezA  [x.x.x] ALANINE DEHYDROGENASE
    4e-14  11%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    4e-14  15%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-14  11%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    5e-14   7%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-14  21%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-14  19%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    7e-14  24%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    9e-14   8%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    9e-14  13%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-13  13%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-13  14%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-13  18%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    3e-13  12%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-13  12%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    3e-13  12%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    4e-13   7%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    5e-13  22%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    5e-13  12%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    7e-13   6%  3donA  [x.x.x] SHIKIMATE DEHYDROGENASE
    8e-13  14%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-12  27%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    1e-12  13%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-12  12%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    2e-12  14%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-12  13%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    2e-12   7%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-12  20%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-12   8%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    4e-12   8%  1dj3A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    9e-12  28%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-12  23%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-11   9%  2e6eB  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-11  13%  3dfzB  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    1e-11   8%  1a4iB  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    2e-11  20%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-11  19%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-11   9%  2a92B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-11   8%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-11   8%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    3e-11  18%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    4e-11  17%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-11  14%  3d7lA  [x.x.x] LIN1944 PROTEIN
    4e-11  21%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-11   7%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    4e-11  20%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-11  16%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-11  17%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    5e-11  12%  1adeA  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    5e-11   8%  1a4iA  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    6e-11  22%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    9e-11  12%  1cg4A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    9e-11  12%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-10  17%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-10   7%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    2e-10  11%  2c82A  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    3e-10  14%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-10  13%  1bw3A  [x.x.x] BARWIN, BASIC BARLEY SEED PROTEIN
    3e-10  21%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    4e-10  12%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    4e-10   9%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    6e-10  14%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    6e-10   9%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    8e-10  11%  2bllA  [x.x.x] PROTEIN YFBG
    9e-10  10%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-09  26%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-09   9%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-09   9%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    2e-09   9%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-09   8%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    2e-09  13%  2e6gA  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-09  18%  3c0bC  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    4e-09  10%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    4e-09  18%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    4e-09  12%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-09  17%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    5e-09  11%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    5e-09  11%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-09   9%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    7e-09  13%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    8e-09  13%  2e6gG  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-08  10%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    1e-08   7%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    1e-08  11%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-08  17%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    1e-08   8%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-08  18%  2e37A  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-08  19%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    2e-08  19%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    2e-08  14%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-08  24%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-08  12%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08   9%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    4e-08   9%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    6e-08  14%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    7e-08  26%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    1e-07  13%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-07  13%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    2e-07  23%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-07  24%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-07  12%  2e6gB  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-07  26%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    3e-07  18%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    3e-07  25%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-07  21%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-07  17%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    4e-07   8%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    5e-07  11%  1b0aA  [c.58.1 - c.2.1] PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
    6e-07  17%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  19%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  16%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    7e-07  27%  3ckyB  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    7e-07  16%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    8e-07  13%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-07  10%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    9e-07  21%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    9e-07  15%  3d7lD  [x.x.x] LIN1944 PROTEIN
    1e-06  19%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    1e-06  12%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-06  25%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-06  12%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    1e-06  19%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-06  13%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    2e-06  20%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    2e-06  21%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    2e-06  23%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    2e-06  11%  3bywA  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-06  13%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-06  22%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-06  11%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-06  19%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    6e-06   6%  2ef0A  [x.x.x] ORNITHINE CARBAMOYLTRANSFERASE
    7e-06  16%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    9e-06  20%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    9e-06   8%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    1e-05  20%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    1e-05  12%  1c14A  [c.2.1] ENOYL REDUCTASE
    1e-05  20%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-05  22%  2amfD  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-05  17%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    2e-05  23%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-05  18%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-05  16%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-05  16%  1ek6B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    3e-05  16%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-05  10%  1buaA  [c.52.1] ENDONUCLEASE ECORV
    3e-05  18%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-05  18%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    3e-05  22%  3ckyA  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    4e-05   4%  2eggB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    4e-05  19%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    4e-05  18%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    5e-05  22%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    6e-05   8%  3dbrG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    7e-05  22%  3e5mB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    8e-05  36%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    8e-05  23%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-05  13%  3c85B  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    8e-05  25%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    8e-05  15%  1arzB  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    9e-05  15%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    9e-05  16%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    9e-05  16%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-04  21%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-04  12%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    1e-04  13%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    1e-04  25%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    2e-04  24%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-04  25%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-04  23%  3c24B  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-04   8%  3dtdA  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    2e-04  22%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    2e-04   7%  1a2zA  [c.56.4] PYRROLIDONE CARBOXYL PEPTIDASE
    3e-04  15%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    4e-04  35%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    5e-04  19%  1dxyA  [x.x.x] D-2-HYDROXYISOCAPROATE DEHYDROGENASE
    5e-04  14%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    5e-04  16%  3d7lB  [x.x.x] LIN1944 PROTEIN
    6e-04  18%  3dnfB  [x.x.x] 4-HYDROXY-3-METHYLBUT-2-ENYL DIPHOSPHATE
    6e-04  21%  2ax3A  [x.x.x] HYPOTHETICAL PROTEIN TM0922
    6e-04  21%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    6e-04  43%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    6e-04  13%  2aemA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    6e-04   7%  2aw5A  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    6e-04  26%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-04  30%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    8e-04  10%  2aefA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    9e-04  37%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    9e-04  33%  2dbqA  [x.x.x] GLYOXYLATE REDUCTASE
    0.001  39%  1bg6A  [x.x.x] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    0.001   8%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
1a27A           -----TVVLITGCS-SGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLSLETLQLDVRDSKSVAAARER
3deyX           -----TVVLITGCS-SGIGLHLAVRLASDPSQSFTQGRLWEAARALACPPLETLQLDVRDSKSVAAARER
1dohB           -----KVALVTGAG-RGIGREMAMELGRRGCKVIVNYANSTESAEEVVASDAACVKANVGVVEDIVRMFE
2ae1A           -----CTALVTGGS-RGIGYGIVEELASLGASVYTCSRNQKELNDCLTQKVEASVCDLSSRSERQELMNT
3ch6E           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEHYIAGTMEDMTFAEQFVA
2cnbB           -----MRVLVCGGA-GYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHWADRYAALEVGDVRNEDFLNG
3d3eA           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAE-QFVA
3dwfC           -----KKVIVTGAS-KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELYIAGSMEDMTFAEEFVA
2ehdA           ----KGAVLITGAS-RGIGEATARLLHAKGYRVGLMARDEKRLQALAAEGALPLPGDVREEGDWA-RAVA
3dwfA           -----KKVIVTGAS-KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELYIAGSMEDMTFAEEFVA
3czrA           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAE-QFVA
1bmdA           MKAP-VRVAVTGAA-GQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMVVMELEDCAFPLLAGLEATDD
1a9zA           -------VLVTGGS-GYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERTFVEGDIRNEALMTEILH
3ce6B           DALIGGKKVLICG-YGDVGKGCAEAMKGQGARVNALQAMMEGFDVVTVEEAIGDADIVVTATGNKDIIML
3d5qC           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAEQFVAQ
2d1yA           -----KGVLVTGGARG-IGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDERERVRFVEE
1b8pA           -----MRVAVTGAA-GQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKGVMMEIDDCAFPLLAGMTAHA
3bmoB           -----PAAVVTGAA-KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADPASCE
2belC           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSASAHYIAGTMEDMTFAEQFVAQ
3edmB           -----RTIVVAGAG-RDIGRACAIRFAQEGANVVLTYNGAAEVAEIEKLGALAIKADLTNAAEVEAAISA
3ctmF           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQSKAYKCNISDPKSVEETISQ
2cnbC           -----MRVLVCGGA-GYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHPWADRYAALEVGDVRNEDFLN
3ce6A           ------------CGYGDVGKGCAEAMKGQGARVSVTEIDPINALQAMMEGFDGDADIVVTATGNKDIIML
3ce6D           ---------VLICGYGDVGKGCAEAMKGQGARVSVTEIDPINALQAMMEGFDVGDADIVVTATGNKDIIM
1c3vA           -------VGVLGAK-GKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHP---DVVMGN
2d1yB           -----KGVLVTGGARG-IGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDERERVRFVEE
3e48A           --------ILTGAT-GHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGVSVRQLDYFNQESVEAFKGD
1dfiA           -----KRILVTGVA-SKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAVLQCDVAEDASIDTMFAE
1bxkA           -----RKILITGGA-GFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVSERFAFEKVDICDRAELA
2b35A           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRITDRLPAKAPLLELDVQNEEHLAAGRVT
2belA           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAE-QFVA
3bzuB           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAEQFVAQ
2e37D           -------VGIVGSG-VGSATAYALALLGVAREVVLVDLDRKLAQAHAEDILHVWVRAGSYGDLE-GARAV
3c2qA           -----ALAKVELGYIQAILAGNALATHDIESALYGTSLGVNIKTAKGHKHHIYAINAINDAGNIKNAVES
2cfcA           ----SRVAIVTGAS-SGNGLAIATRFLARGDRVAALDLSAETLEETARTRVRADVADEGDVNAAIAATME
2d1yD           -----KGVLVTGGARG-IGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDERERVRFVEE
1di7A           -----------------------------GLVSISDRYQDKGEEWLTSALTTPETRLIPDEQAIIEQTLC
3e9qA           -----RIILVTGAS-DGIGREAATYARYGATVILLGRNEEKLRQVASHINEETGRQLTCTSENCQ-QLAQ
3cq0B           -----AASKLEKYA-RFIDAAVEYGRKHGKTDHEKIENAMDKILVEFGTQILSTEVDARLSFDKKATVKK
1dj2A           -----AKSFIGTTKRG-IGPAYSSKVIRNGIRVGDLRHMDTLPQKLDLLLSDAAARFQGFKYTPEMEEVE
2d1yC           -----KGVLVTGGARG-IGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDERERVRFVEE
2c29F           ----SETVCVTGAS-GFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLTLWKADLADEGSFDEAIKGCT
3c2qB           -----GGPALAKVELGAILAGNALATHDIESALYGTSLGVNIKTAKPVTHHIYAINAINDAGNIKNAVES
2ag5A           -----KVIILTAAAQG-IGQAAALAFAREGAKVIATDINESKLQELEKYPIQTRVLDVTKKKQIDQFANE
1bxkB           -----RKILITGGA-GFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDIDRAEL
1c9yA           -------TLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKL----LLTN
2ehdB           -----GAVLITGAS-RGIGEATARLLHAKGYRVGLMARDEKRLQALAAEGALPLPGDVREEGDWAR-AVA
2cnbA           -----MRVLVCGGA-GYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVAALEVGDVRNEDFLNGVFTR
2eghA           -----KQLTILGST-GSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEEFSPRYAVMDDEASAKL-LKT
2b35E           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLAS
3d3wA           -----RRVLVTGAG-KGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCV---DLGDWEATE
2a4kA           -----KTILVTGAA-SGIGRAALDLFAREGASLVAVDREEEAVAALEAEAIAV-VADVSDPKAVEAVFAE
2a4kB           -----KTILVTGAA-SGIGRAALDLFAREGASLVAVDREEEAVAALEAEAIAV-VADVSDPKAVEAVFAE
3bmeC           ----APAAVVTGAA-KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNVVQADLTNSNVLPASCEE
3ch6B           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEYIAGTMEDMTFAEQFVAQ
3e03C           -----KTLFITGAS-RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSALKCDIREEDQVRAAVAA
3e03B           -----KTLFITGAS-RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSALKCDIREEDQVRAAVAA
2e37E           -------VGIVGSG-VGSATAYALALLGVAREVVLVDLDRKLAQAHAEDFAHPVWVRAGSYGDLEGARAV
2e37B           -------VGIVGSG-VGSATAYALALLGVAREVVLVDLDRKLAQAHAEDAHPVWVRAGSYGDLE-GARAV
2a92C           -----KPKIVLVGS-GMIGGVMATLIVQKNLGDVVMFDVVKNMP----QGKALDTSHSNVMAYSNCKVTG
3e6vA           VKKNGRISLVLGGDHS-LAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGN-LHGQPVSFLLKELKG
2dknA           -------IAITG-SASGIGAALKELLARAGHTVIGIDRGQADIEADTAVAAVLDRCGGVLDGLVCCAGVG
3dfzA           -----RSVLVVGG--GTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFF
2e6hB           -------------------------------RILVTNDDGIYSPGL-----WALAEAASQFGEVFVAAPD
1bdmA           -----VRVAVTGAA-GQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLL---
3bhmA           -----HVALVTGGN-KGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAE-GLSPRFHQLDIDDLQ
1bsvA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLA-----
2dknB           -------IAITG-SASGIGAALKELLARAGHTVIGIDRGQADIEADLSTRETAVAAVLDRCGGVL-DGLV
3dtdB           -----------------------------------SLTETYGNCGIQEGKKVCFMHEVNDQNRVVVAMSV
2b4qB           -----RIALVTGGS-RGIGQMIAQGLLEAGARVFICARDAEACADTATRDCQAIPADLSSEAGARRLAQA
1e7qA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVELVLRTRDELNLL-----------DSRAVHDFFASERI
1bhsA           -----TVVLITGCS-SGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRCPPGSLETLQLDVRDSKSVAAA
2belD           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEYIAGTMEDMTFAE-QFVA
1d0iA           -----PIMILNGPNLN-LLGQR-------QPEIYGSDTLADVEALCVKAAAHGGTVDFRQSNHEGELVDW
2ag5B           -----KVIILTAAAQG-IGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRLDVTKKKQIDQFANE
2e6bD           ----------------------------TNDDGIYSPGLWALAEAASQFGEVFVAAPDTHAITIAHPVRA
3d5qD           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHSAHYIAGTMEDMTFAEQFVAQ
2c54B           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFHLVDLRVMENCLKVTEGVDHV
2e6eD           -------------------------------RILVTNDDGIYSPGLWALEVFVAAPDIAHPVRAYPHPPH
2ag5C           -----KVIILTAAAQG-IGQAAALAFAREGAKVIATDINESKLQELEKYGIQTRVLDVTKKKQIDQFANE
2e6cD           ----------------------------TNDDGIYSPGLWALAEAASQFGEVFVAAPDTHAITIAHPVRA
2c5aB           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVDHV
2ekqD           -----RKALVTGGS-RGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALE
3dbhC           -----AHVCLINA--TATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSI--GKNRAEAAME
2e37C           -------VGIVGSG-VGSATAYALALLGVAREVVLVDLDRKLAQAHAEDFAHPVWVRAGSYGDLEGARAV
2eezA           ------SVVILGG--GTVGTNAAKIALGMGAQVTILDVNHKRLQYLDDVFGGRVITLTATEANIKKSVQH
1e7sA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK--
3ek2A           -----KRILLTGLL-SNRSIAYGIAKACKREGAELAFTYVGDRFKDRITSELVFPCDVADDAQIDALFAS
1c9kB           -------ILVTGGA-RSGKSRHAEALIGDAPQVLYIATSQILDDEMIQHHKDGRPAHWRTAECWRHLDTL
2e6gK           -------------------------------RILVTNDDGIYSPGL-----WALAEAASQFGEVFVAAPD
3edmC           -----RTIVVAGAG-RDIGRACAIRFAQEGANVVLTYNGAAEVAEIEKLGALAIKADLTNAAEVEAAISA
3diiA           -------VIVTGGGHG-IGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFDVADPLTLKKFVEY
1edoA           ----SPVVVVTGAS-RGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKGQAITFGGDVSKEADVEAMMK
2aw5B           ----SDQTILFQG-AGEAALGIAHLIVMALEKEGLPKEKAIKKIWLKGLIVKGQEKEKFAHEHEE-MKNL
2c54A           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMFCDEFHLVDLRVMENCLKVTEGVDHV
1c9kA           -------ILVTGGA-RSGKSRHAEALIGDAPQVLYIATSQ---IARIQHHKDGRPAHWRTAECWRHLDTL
2e6hC           ----------------------------TNDDGIYSPGLWALAEAASQFGEVFVAAPDGHAITIAHPVRA
3dijA           -------VIVTGGGHG-IGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFDVADPLTLK-KFVE
3d64A           DVMIAGKIAVVAGYGD-VGKGCAQSLRGLGATVWVTEIDPICALQAAMEGYRVKADIFVTATGNYHVINH
1cg3A           REKARGAKAIGTTG-RGIGPAYEDKVALRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQK
1di6A           -------LVSISDR-DKGIPALEEWLTSALTTPFELETRL----------------IPDEQAIIEQTLCE
3dxfB           -----KLVVVFGGT-GAQGGSVARTLLEDGTFKVRVVTANPKAAKELRLQGAEVVQGDQDDQVIMELALN
3dwfB           -----KKVIVTGAS-KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARASAHYIAGSMEDMTFAEEFVA
1cg1A           -----GAKAIGTTG-RGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEQLVNYYKAEAVDYQKVLDDTMA
3donA           ----------------------------------------------------------------------
2c5eA           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDEFHLVDLRVMENCLKVTEGVDHV
3csdB           -----EVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREGRTCDVRSVPEIEALVAA
2c59B           -----LKISITGAG-GFIASHIARRLKHEGHYVIAKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHV
2dfdA           ----NAKVAVLGAS-GGIGQPLSLLLKNSPLVSRLTLYDIAHT----------PGVAADLSHIETKAAVK
2c5eB           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFHLVDLRVMENCLKVTEGVDHV
1dhrA           -----RRVLVYGGR-GALGSRCVQAFRARNWWVASIDVVEN--EEASASVIVKMTDSFTEQADQVTAEVG
3bywC           -----DLILGTLPA-NSEDAGARGLFVRANDDGLQITSHGELLDLSKREDATIAISATEDETTAGIEGDD
2ekpA           -----RKALVTGGS-RGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALE
3dooA           ----------------------------------------------------------------------
1dj3A           REAELANSFIGTTK-RGIGPCYSSKVTRNGLRVCDLRHMDTFGDKLDVLFEDAA--ARFEGFKYSKGMLK
3ch6D           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEHYIAGTMEDMTFAEQFVA
1ahhA           -----KCAIITGAG-AGIGKEIAITFATAGASVVVSDINADAANHVVDEQAFACRCDITSEQELSALADF
2e6eB           ----------------------------TNDDGIYSPGLWALAEAASQFGEVF---VAAPDTTIAHPVRA
3dfzB           -----RSVLVVGG--GTIATRRIKGFLQEGAAITVVAPINEWEAKGQLRVKRKKVGDLLNVFFIVVATND
1a4iB           ----GRHAVVVGR-SKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVATGQPEMVK-GEWIKP
3e03A           -----KTLFITGAS-RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSALKCDIREEDQVRAAVAA
3ek2D           -----KRILLTGLLSNSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVADDAQID
2a92B           -----KPKIVLVGS-GMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSY
2e6cC           -------------------------------RILVTNDDGIYSPGLWALEVFVAAPDTEQSAAGHAITIA
2axqA           -----KNVLLLGS--GFVAQPVIDTLAANDDINVTVACRTLANAQ-----ALAKPSGSKAISLDVTDDSA
3ctmH           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYG--VHSKAYKCNISDPK
3ek2B           -----KRILLTGLL-SNRSIAYGIAKACKREGAGDRFKDRITEFAAEFGSELVFPCDVADDAQI-DALFA
3d7lA           ---SNAKILLIGAS-GTLGSAVKERLEKKAEVI-----------------TAGRHSGDVTVDITN-IDSI
3edmA           -----RTIVVAGAG-RDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAE
2aw5C           ----SDQTILFQGAGE-AALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGQEKEKHEHEEMKNL
3edmD           -----RTIVVAGAG-RDIGRACAIRFAQEGANVVLTYNGAEGAATAVAEIEKLIKADLTNAAEVEAAISA
2e6bC           ----------------------------TNDDGIYSPGLWALAEAASQFGVFVAAPDTHAITIAH---PV
1d7oA           -----KRAFIAGIADDGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLVKANKRYAGSSNWTVQEA-AE
1adeA           -----GAKAIGTTG-RGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVLVNYYKAEAVDYQKVLDDTMA
1a4iA           -----RHAVVVGR-SKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDIMVKGEWIKPGAIV-IDCG
2bgkA           -----KVAIITGGA-GGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNVISFVHCDVTKDEDVR-NLVD
1cg4A           -----GAKAIGTTGRG-IGPAYEDKVARRGLRVGDLFDKETFAEKLKFQLVNYYKAEAVDYQKVLDDTMA
2aqiA           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLLPAKAPLLELDVQNEEHLASLAGRVTE
2c5aA           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEH
2eggA           ----------------------------------------------------------------------
2c82A           -----LRVVVLGST-GSIGTQALQVIADNPDRFEVVGLAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI
2c59A           -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTEDEFHLVDLRVMENCLKVTEGVDHV
1bw3A           -----YYRPAQNNW-DLGAPAVSAYCATWDASKPLSWRSKYGWTAFRGQAACGKCLRVTNPATGAQITAR
3ctmG           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQSKAYKCNISDPKSVEETISQ
3c85C           LINPGHAQVLILG--GRIGTGAYDELRARYGKISLIEIREEAAQQHRSEGRNVISGDATDPDFWER----
3d5tC           -----KRVAVTGAA-GQIAYSLLFRIANGDLLGKDQPVILQQAQAAVKGVVMELDDCAFPLLAGVVITDD
2cukA           ---------------GRIGQAVAKRALAFGMRVVYHARTPKPFLSLEELLADVVSLHTPLTPETH-RLLN
2a92A           -----KPKIVLVGS-GMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSY
2bllA           -------VLILGVN-GFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHWIEYHVK
3bywB           -----DLILGTLPA-NSEDAGARGLFVRANDDGLQITSHGELKRELAQLPADATIAATEDETTAGIEGDD
2belB           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQELGAASAHYIAGTMEDMTFA-EQFVA
3bywD           -----DLILGTLPA-NSEDAGARGLFRANDDGLQITSHGELVKRELAQLPADATIAATEDET---TAGIE
3d3jA           -----ALLCGPHVK-GAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSK------TQGQQVSS
3bywH           -----DLILGTLPA-NSEDAGARGLFVRANDDGLQITSHGELKRELAQLPADATIAATEDETTAGIEGDD
1civA           -----INVAVSGAA-GMISNHLLFKLASGEVFGPDQPISLKLLGSELEGVAMELEDSLYPLLRQVSIGID
2e6gA           ----------------------------TNDDGIYSPGLWALAEAASQFGE----VFVAAPDAHPVRAYP
3c0bC           ---------ILGIDIGG--ANTKITELHENGEFKVHHLYFPDLKTYSNDVS-HVALVTTAEEGVDNILNA
3bywF           -----DLILGTLPA-NSEDAGARGFVRANDDGLQITSHGELVKRELAQLPADATIAATEDETTAGIEGDD
3ctmB           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDP-KS
2b35D           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITPLLELDVQNEEHLASLAGRVTE
1cwuA           -----KRAFIAGIADDGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPNWTVQEAAE
1bwsA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVELVLRTRDELN----LLDSRAVHDFFASERIDQVYLAA
1e6uA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVG
3d3uA           --------------ELRIGQNCASLIKDGDTLQLGIGGIPDAVLRA-----LEGHKDLGIHTEMFTDGVM
2b37C           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDPLLELDVQNEEHLASLAGRVT
2e6gG           ----------------------------TNDDGIYSPGLWALAEAASQFGEVFVAATITIAHPVRAYPHP
1cbuC           -------ILVTGGA-RSGKSRHAEALIGDAPQVLYIATSQILDDEMAARIQHHDGRPAHWRTAECWDTLI
3e48B           --------ILTGAT-GHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRKVSVRQLDYFNQESVEAFKGD
2b35C           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLAS
2a35A           -----KRVLLAGAT-GLTGEHLLDRILSEPTLAKVIAPAR------------KALAEHPRLDNPVGPLAE
2e6hD           -------------------------------RILVTNDDGIYSPGLWALAEA--ASQFGEVFVAAPDTAG
2e37A           -------VGIVGSG-VGSATAYALALLGVAREVVLVDLDRKLAQAHAEPFAHPVWVRAGSYGDLEGARAV
3ctmE           -----KVASVTGSSGGIEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEETISQ
3ctmA           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGKAYKCNISDPKSVEES
3ek2C           -----KRILLTGLL-SNRSIAYGIAKACKREGAELAFTFKDRITEFAAEFGSELVFDVADDAQIDALFAS
3bzuD           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARETLQKVVSHCLELGAASAHYMEDMTFAEQFVA
2b35B           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITPLLELDVQNEEHLASLAGRVTE
3e5mA           -----KLVVVFGGT-GAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGA-EVVQGDQDDQVIM-E
3c6cA           ----------------------------------------------------------------------
3c3xA           ----KSKILIFGGT-GYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSL---GAIIVKGELDEHEK
2bd0A           -----HILLITGAG-KGIGRAIALEFARAARHHPDFEPVLVLSSRTAADALTDTITADISDMADVRRLTT
2aqkA           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFQRITDRLPAKAPLLELDVQNEEHLASLAGRVT
2a35B           -----KRVLLAGAT-GLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQL-------
3d5qB           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTF
3d4nB           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVA
2e6gB           ----------------------------TNDDGIYSPGLWALAEAASQFGEVFVAAIAHPVRAYPHPSPL
2ae2A           -----CTALVTGGS-RGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKDLSSRSERQELMNT
1e7wB           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVA
3byzA           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIATFAEQFVA
3d4nC           -----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCASAHYIAGTMEDMTFAEQFVA
1e92A           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVA
1bdmB           MKAP-VRVAVTGAA-GQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGL
1b0aA           -----LNAVVIGASNI-VGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLFIPGDWIKEGAIVIDVG
2bf7A           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAITVQADLSNVATAPAPVTLFTRCAELVA
2bfoA           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSLVA
3ctmD           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDP-KS
3ckyB           ----SIKIGFIGL--GAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQAC----------------
3bmnD           -----PAAVVTGAA-KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSC
2b37B           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLELDVQNEEHLASLAGRVTE
3dxfA           -----KLVVVFGGT-GAQGGSVARTLLEDGTFKVRVVTANPRKKAAKELRLQGAEVVQGDQDDQVIMELA
3e9qB           -----RIILVTGAS-DGIGREAATYARYGATVILLGRNEEKLRQVASHQPQWFILDLLTCTSENCQQLAQ
3d7lD           -----AKILLIGAS-GTLGSAVKERLEKKAEVITAGRHSGDVTVDITNIDSIKKYEQVGKVDA-------
2bfaA           -----PVALVTGAA-KRLGRSIAEGLHAEGYATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVA
2b36B           -----KRILVSGIITDSIAFHIARVAQEQGAQLLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVTE
3d4nD           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVA
2dt8A           -----RITLVTDST-SDLPQDLRGRLVNLSGAIYRDWEEITPTEIFQKVRAAFPTTSQPSPEDFARVYRE
2bfmB           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAATVQADLSNVATAPVAPVTLFTRCAELVA
2aq8A           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQAKAPLLELDVQNEEHLASLAGRVTE
3cxrA           -----KIALVTGASYGIGFAIASAYAKAGATIVFNDLVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVA
2b4qA           -----RIALVTGGSRGMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLSSEAGARRLAQ
1ae1A           WSLKGTTALVTGGSKGIGYAAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQT
3bywA           -----DLILGTLPA-NSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELAQLPAATEDETTAGIEGDD
2b35F           -----KRILVSGIITDSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLAS
3ch6A           -----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCASAHYIAGTMEDMTFAEQFVA
2aqhA           -----KRILVSGIITDSVAFHIARVAQEQGAQLVLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVT
2bfaB           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHRRPNSAITVQADLSNVATAPAPVTLFTRCAELVA
2ef0A           GGLAGLEVAWV-GDGNNVLNSLLEVAPLAGLKVRVATPKGYEPKRANAFFTHDPKEAALGAHAL-YTDVW
2c29D           -----ETVCVTGAS-GFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEG
2amfA           ----AMKIGIIGV--GKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMS-------------
1d4gA           -----------------------------------------------------KEGNIFVTTTGCVDIIL
3bmqC           -----PAAVVTGAA-KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTIIN
1c14A           -----KRILVTGVA-SKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVGSDIVLQCDVAEDASIDTMFAE
3e9nC           -----KIAVVTGAT-GGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGG---
2amfD           ---NAMKIGIIGV--GKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPY----------------
3ctmC           -----KVASVTGSS-GGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSV
3c24A           -----KTVAILGA--GGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIPLTD----------------
3e9nB           -----KIAVVTGAT-GGMGIEIVKDLSRDHIVYALGRNPEHL----------AALAEIEGVEPIESDIVK
2bfoC           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNNVATAPVTLFTRCAELVA
1ek6B           ----AEKVLVTGGA-GYIGSHTVLELLEAGYLPVVFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGAL
1e3sA           -----LVAVITGGA-SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVALTLAKEKF
1buaA           -----YNINELNEI-PKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLD
2bfaC           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSSNVATAPAPVTLFTRCAELVAA
2c0cA           -----KKVLVTAAA-GGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKT-----EPVGTV
3ckyA           ----SIKIGFIGL--GAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQAC---ENNQKVAAASDII
2eggB           NITLDGKRSDIIYN-QNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIE---------------------
2bfaD           -----PVALVTGAA-KRLGRSIAEGLHAEGYAVCNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVA
1dohA           -----KVALVTGAG-RGIGREMAMELGRRGCKVIVNYANSTESAEEVVASDAACVKANVGVVEDIVRMFE
2amfE           ---NAMKIGIIGV--GKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPY----------------
3dbrG           -----AHVCLINA--TATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFF-LQRSSIGKNRAEAAMEF
3e5mB           -----KLVVVFGGT-GAQGGSVARTLLEDGTFKVRVVT--------------------------------
2c20A           ------SILICGGA-GYIGSHAVKKLVDEGLSVVV-----------------------------------
3d3eB           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVA
3c85B           LINPGHAQVLILG--GRIGTGAYDELRRYGKISLGIEIREEAAQQHRSEGRNVISGDATDPD-------F
2bkaA           -----KSVFILGAS-GETGRVLLKEILEQGLFSK------------------------------------
1arzB           ----NIRVAIAGAG-GRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQS-----
1ek5A           ----AEKVLVTGGA-GYIGSHTVLELLEAGYLPVVIDNFHNAFRGLRRVQELTGRSVEFEEMDILDQGAL
3bmnC           -----PAAVVTGAA-KRIGRAIAVKLHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIIN
1e6wB           -----LVAVITGGA-SGLGLSTAKRLVGQGATAVGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKF
2amfC           ------KIGIIGV--GKMASAIIKGLKQTPHELIISGSSLERSKEIAEQL--------------------
2aefB           -----RHVVICGW--SESTLECLRELRGSEVFVLAEDENVRKKVL--RSGANFVHGDPTRVSDLEKANV-
1e5lA           -----KSVLMLGS--GFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAA-LDAE
3cxtA           -----KIALVTGAS-YGIGFAIAAYAKAGATIVFNDINQELVDRGMAGINAHGYVCDVTDEDGIQAM-VA
3d5qA           -----KKVIVTGAS-KGIGRAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVA
3bzuA           -----KKVIVTGAS-KGIGREMAYHLAKMGAHVVVTARKVVSHCLELGAASAHYIAGTMEDMTFAEQFVA
3c24B           -----KTVAILGA--GGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIPLTDG---------------
3dtdA           ----------------------------------------------------------------------
1e3jA           ---------------GPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKEEESSIIER
1a2zA           -----KKVLITGFE-PFGGDSKNPTEQIAKYFDRKQIG--NAMVYGRVLPVSVKRATIELKRYLEEIKP-
2aejB           -----RHVVICGW--SESTLECLRELRGSEVFVLAEDENVRKKVL--RSGANFVHGDPTRVSDLEKANV-
3dhnA           -----KKIVLIGAS-GFVGSALLNEA--------------------------------------------
1dxyA           KELGQQTVGVMGT--GHIGQVAIKLFKGFGAKVIAYDPYPMKGDHPDFDY--------------------
2cd9A           GTLNCRKVLVVGT--GPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEET----KTNYYNSSNGYDKL
3d7lB           ------KILLIGAS-GTLGSAVKERLEKKAEV------------------ITAGRHSGDVTVDITNIDSI
3dnfB           ---------TVIIRSHGIPPEKEEALRKKGLKVIDVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGY
2ax3A           ------LVLCGGGNNGGDGFVVARNLLGVVKLVVFLGKKKTPDCEYNYGLYKK-----FGGKVVEQFEPS
3dojA           -----MEVGFLGL--GIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVC---ESPAEVIKKCKYT
1db3A           ----SKVALITGVT-GQDGSYLAEFLLEKGYEV-------------------------------------
2aemA           -----RHVVICGW--SESTLECLRELRGSEVFVLAEDENVRKKVL-------------------------
2aw5A           ----SDQTILFQG-AGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGQEKEKHEHEEMKNL
1e7rA           -----QRVFIAGHR-GMVGSAIRRQLEQRGDVE-------------------------------------
3eheA           -------IVVTGGA-GFIGSHVVDKLSESNEIVVI-----------------------------------
2aefA           -----RHVVICGW--SESTLECLRELRGSEVFVLAEDE---NVRKKVLRSGANFVHGDPTRVSDLEKANV
2b69A           -----KRILITGGA-GFVGSHLTDKLDGHEVTV-------------------------------------
2dbqA           -----KTIGIIGL--GRIGQAIAKRAKGFNRILYYSRTRKEEVERELNAEFKP-----------------
1bg6A           ----SKTYAVLGL--GNGGHAFAAYLALKGQSVL------------------------------------
3eeqB           --------------HWGANDIARELSVILNSTPIITKLSIERIA---------NILIAKIINPENIVKIN


                         .         .         *         .         .         .         .:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
1a27A           V---TEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
3deyX           V---TEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1dohB           EAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRL-ILMGSITGQ
2ae1A           VANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSG
3ch6E           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-IVVVSSLAG
2cnbB           VFTRHGP-IDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEP
3d3eA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
3dwfC           EAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGS-IAVVSSVAG
2ehdA           AMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAG
3dwfA           EAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGS-IAVVSSVAG
3czrA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
1bmdA           PDVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAYKN
1a9zA           DH-AIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDNPKIPYVES
3ce6B           EHIKAMK-DHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATG
3d5qC           AGKLMGGL-DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
2d1yA           AAYALGR-VDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
1b8pA           DPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRIKVLVVGNPANTNAYIAMKS
3bmoB           EIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAM
2belC           AGKL-MGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-IVVVSSLAG
3edmB           AADKFGE-IHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGR
3ctmF           QEKDFGT-IDVFVANAG-------VTWTQGPENKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
2cnbC           GVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEP
3ce6A           EHIK-AMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATG
3ce6D           LEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATG
1c3vA           LEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIEL
2d1yB           AAYALGR-VDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
3e48A           TVVFIPS-IIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLLSTSGIDYTY
1dfiA           LGKV-WPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISFVAMAKACRSMLNPGSALLTLSYLGA
1bxkA           RVFTEHQ-PDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDE
2b35A           EAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYASMAKALLPIMNPGGSIVGMDFDP
2belA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
3bzuB           AGKLMGGL-DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVV-VSSLAG
2e37D           VLAAGVARLQLLDRNAQVFAQVVPRVLEAALLVATNPVDVTQVAYRLSGLPP-GRVVGSGTILDTARFRA
3c2qA           GV-LKEGIYQCIKNNIPYVLAGSIRDDG---PIPDVITDSVAQDKRTTVDKKVILSTLLHSVATGNL---
2cfcA           QFGAIDV-LVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVAS
2d1yD           AA-YALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
1di7A           ELVDEMS-CHLVLTTGGTGPARRDVTPD--ATLAVADREMPGFGEQMHFVPTAILSRQVGVIRKQALILN
3e9qA           RIVVNYPRLDGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFLTQAL--LPLLLKSDAGSLVFTSSSVG
3cq0B           ALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVG
1dj2A           AYKRYADRLEPYITDTVHFINDSISQKK-----KVLVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLG
2d1yC           AA-YALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
2c29F           GVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSD
3c2qB           GVLKEGI-YQCIKNNIPYVLAGSIRDDGPI---PDVITDSVAQDKRTTVDKKVILSTLLHSVATGNL---
2ag5A           V-----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
1bxkB           ARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDE
1c9yA           DPLEAAHGGNVLITDTWISMGREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEV---
2ehdB           AMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAG
2cnbA           H-GPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTNAEPIDI
2eghA           MLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANK-ESLVTCGRLFM
2b35E           LAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPSIVGMDFDP
3d3wA           RALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQS
2a4kA           ALEEFGR-LHGVAHFAGVAHSALPLEAWEK----VLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLG
2a4kB           ALEEFGR-LHGVAHFAGV------------AWEKVLRVNLTGSFLVARKAGEVLEEGG-------SLVL-
3bmeC           IINSCFR-AFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAM
3ch6B           AGKLMGG-LDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVV-VSSLAG
3e03C           TVDTFGG-IDILVNNASAIWL--RGTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPS
3e03B           TVDTFGG-IDILVNNASAIWLRGTLDTPK--RFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPS
2e37E           VLRPGETRLQLLDRNAQVFAQVVPRVLEAPEAVLLVATNPVDVTQVAYRLSGLPPGRGSGTILDTARFRA
2e37B           VLAAGVARLQLLDRNAQVFAQVVLEAAPEAVL--LVATNPVDVTQVAYRLSGLPPGRVVGSGTILDTARF
2a92C           SNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVEH
3e6vA           KIPDVPG-FSWVTPCISAKDIVGLRDVNPGEYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDG
2dknA           VTAANSLVVAVNYFGVSALLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAM-LAGDEARAIELA
3dfzA           IVVATNDQNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECR
2e6hB           HAITIAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHS--GTVAA
1bdmA           --AGLEATDDPDVAFKDADYALLVGAAPLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAYKN
3bhmA           FLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGR--VVNVSSIMS
1bsvA           ------AAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQ
2dknB           CCAGVNSGLVVAVNYFGALLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEA-RAIELA
3dtdB           VLNADGTVPFGILVSKPVRLQVDGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGK-HLKLAMTIAAP
2b4qB           LGELSAR-LDILVNNAGTSPVSGWEKVMQL----NVTSVFSCIQQLLPLLRRSASAENPARVINIGSVAG
1e7qA           DQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESELLQ
1bhsA           RERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2belD           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
1d0iA           IHEARLNHCGIVINPAAYSHTAILDALNTCDGLPVVEVHISNIH---------QREPFRHHSYVSQRADG
2ag5B           V-----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
2e6bD           Y--PHPSPLHAPHFPAYRVRGTPADCVALG---LHLFGPVDLVLSGVNLGSNLGHE-----IWHSGTVAA
3d5qD           AG-KLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
2c54B           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET-TNVSLKESD
2e6eD           FPAYRVTPADCVALGLHLFGPVDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVPDFAGLRPRLERPFLVN
2ag5C           V-----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMAQKSGNIINMSSVASS
2e6cD           Y--PHPSPLHAPHFPAYRVRGTPADCVA---LGLHLFGPVDLVLSG------VNLGSNLGHEIWHSTVAA
2c5aB           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQL-ETTNVSLKESD
2ekqD           AL----GGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAGWGRVLFIGSVTTFT
3dbhC           FLQELNSDVSGSFVEESPENLLDNDPSFFCR----FTVVVATQLPESTSLRLADVLWNSQIPLLICRTYG
2e37C           VLAPGETRLQLLDRNAQVFAQVVLEAAPEAVL--LVATNPVDVTQVAYRLSGLPPGRVVGSILDTARFYL
2eezA           ADLLIGAV-LKLVTRDMLSLMGAVI-VDVAYV-------VDGVVHYGVANMPGAVPRTSTFALTNQTLPY
1e7sA           ---------VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQ
3ek2A           LK-THWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKPMLSDDASLLTLSYLGA
1c9kB           ITADLAPDDAILLECITMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVG
2e6gK           TITIAHP-VRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHS--GTVAA
3edmC           AADKFGE-IHGLVHVGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTF-SSQAGR
3diiA           AM-EKLQRIDVLVNNACG-SKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGR-IINIASTRA
1edoA           TAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVG
2aw5B           EAIVQEIKPTALIGVAAIGGEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFD
2c54A           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQ-LETTNVSLKESD
1c9kA           ITADLAPDDAILLECITTMVTNLLFALDPE---QWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVG
2e6hC           Y-----PHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSG------VNLGSNLGHEIWHSTVAA
3dijA           YAMEKLQRIDVLVNNACG-SKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIIN-IASTRA
3d64A           DHMKAMRH-NAIVCNIGHFDSEIDVAST---RQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATG
1cg3A           VLDDTMAVADILTSM--VVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSG
1di6A           LVDEMSC--HLVLTTGGTGPARRDVTPDA--TLAVADREMPGFGEQMRQ---ISLHFVPTAILSRQVGVI
3dxfB           GAYAEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYFRDIGVPMTSVRLPCY
3dwfB           EAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAV-VSSVAG
1cg1A           VADIL---------TSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSG
3donA           ----------SHLDEFDIIINTTPDSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFV
2c5eA           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQL-ETTNVSLKESD
3csdB           VVERYGP-VDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGTGRIVNIAST
2c59B           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET-TNVSLKESD
2dfdA           GYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTI
2c5eB           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQ-LETTNVSLKESD
1dhrA           KLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALD
3bywC           STTRDVRPIIGIYTELE-----------------------------------------------------
2ekpA           AL----GGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAGWGRVLFIGSVTTFT
3dooA           ------------------------TPVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFV
1dj3A           EEVERYKKFAERLEPFIADTVHVLNESIRQKKKILVEGGQATML-DIDFGTYPFVTSSSPSAGGICTGLG
3ch6D           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAG
1ahhA           AISKLGKVDILV--NNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
2e6eB           YP-HPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLAAAKQ----GYLFGLSAAAFSVPLEVPD
3dfzB           QAVNVKIKNDQLVNMASSFSDGNIQIFSRGRLSLAISTDGASPLLTKRIKEDLNYDESYTQYTQFLYECR
1a4iB           GAIVIDCGINYVPDDKKPNG-----------RKVVGDVAYDEAKERASFITPVPG----GVGPMTVAMLM
3e03A           TVDTFGG-IDILVNNASAIWLRGTLDTPKRF--DLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPS
3ek2D           ALKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPDDASLLTLSYLGA
2a92B           DDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMLLFEH
2e6cC           ------HPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGEIWHSGTVAA
2axqA           LDKVLAD-NDVVISLIPYTFHPNVVKSAIRTKTDVVTSSYI--SPALRELEPEIVK---AGITVMNEIGL
3ctmH           SVEETISQQEKDFGTIDVFVANAGVTWTQGPEIKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
3ek2B           SLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDASLLTLSYLGA
3d7lA           KKYEQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDKGSFTLTTG-----
3edmA           VAADKFGEIHGLVHVAGGLIARKTAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGA-IVTFSSQAGR
2aw5C           EAIVQEIKPTALIGVAAAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFD
3edmD           AADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTF-SSQAGR
2e6bC           RAYPHPSPLHAPHFPAYRVRGT---PADCVALGLHLFGPVDLVLSGV------NLGSNLGHEIWHSGVAA
1d7oA           CVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLISASSYSFVSLLSHFLPIMNPGG-ASISLTYIASE
1adeA           VALTSMVVDVSDLLDQARQRGD-------FVMFEGAQGTLLDIDHGTYPYVT----SSNTTAGGVATGSG
1a4iA           INYKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRF-----------------------
2bgkA           TTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDVYGAFLVAKHAARVMIPAKKGSIVFTAISSF
1cg4A           VADILTSVDVSDLLDQARQRGD-------FVMFEGAQGTLLDIDHGTY----PYVTSSNTTAGGVATGSG
2aqiA           AIGAGNKL-DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLMNPGGSIVGMDFDP
2c5aA           VFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESD
2eggA           ------------------------VQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLV
2c82A           PYHGSDA-ATRLVEQTEADLVGALGLRPT-----LAALKTGARLALANKESLVAGGSLVLRAARPG----
2c59A           FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET-TNVSLKESD
1bw3A           IVDQANGGLDLDWDTVF----TKIDTNGIGYQQGHLNVNYQF----------------------------
3ctmG           Q-EKDFGTIDVFVANAGVTW----TVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
3c85C           ---ILDTGHVKLVLLAP---HHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAG
3d5tC           PKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKS
2cukA           RERLFAMKRGAILLNTARGALVDTEALV-----EALRGHLFGAGLDVTDPEPLPPGHPLYALPNAVIT--
2a92A           DDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLF
2bllA           KCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTVYGMCSDKYFDEDHSNLIV
3bywB           STTETV--ERDVRPIIG-----------------------------------------------------
2belB           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GSIVVVSSLAG
3bywD           GDDSTTETVERDVRPI----IGIYTELE------------------------------------------
3d3jA           LKDLPTSPVDLVINCLDCPENVFLRDQPWYK--AAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLG
3bywH           ---STTETVERDVRPI----IGIYTELE------------------------------------------
1civA           PYEIFQDAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVVGNPCNTNALICLKN
2e6gA           HP--SPAPHFPAYRVRGTPADCVALGLH---LFGPVDLVLSGVNLGS---------NLGHEIWHSGTVAA
3c0bC           AESAFGSNISVFDSNGNFISLESAKTNNKVSA-----------SNWCGTAKWVSKNIEENCILVDGSTTT
3bywF           STTETV--ERDVRPIIG-----------------------------------------------------
3ctmB           VEETISQQEKDFGTIDVFVANAGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
2b35D           AIGAGNKLDGVVHSIGFMPTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDP
1cwuA           CVRQDFGSIDILVHSLGNGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLYIASE
1bwsA           A-------KVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQ
1e6uA           -----------GIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQ
3d3uA           RMIRKGI-INGKKKTLHPEKVVTSLIFGSKELYDFVNNNPVIECYPVDYINNPDVIGDRMVSINSCLEMD
2b37C           EAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYAAKALLPIMNPGGSIVGMDFDP
2e6gG           S--PLHAPHFPAYRVRGTPADCVALGLH-------LFGPVDL--VLS----GVNLGSNLGHEIWHSGTVA
1cbuC           TADLAPDDAILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVG
3e48B           TVVFIPSI-IHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLLSTSGIDYTY
2b35C           LAGRVTEAIDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHAYSYASMAKALLPIMNPGGSIVGMDFDP
2a35A           LLPQLDGSIDTAFCC----------LGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSA--L
2e6hD           HAITIAHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHGTVAA
2e37A           VLAPGETRLQLLDRNAQVFAQVVLEAAPEAVL--LVATNPVDVTQVAYRLSGPGRVVGSGTILDTARFRA
3ctmE           QEKDFGTI-DVFVANAGVTWTDNYDSWN-----KIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
3ctmA           QQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKG-SLIITSSIS
3ek2C           LKTHWDSL-DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDASLLTLSYLGA
3bzuD           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGK
2b35B           AIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNGGSIVGMDFDP
3e5mA           LALNGAYATFIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFD-----
3c6cA           -------------------------------------------------IKPELEVFSPGDILFGKQLIL
3c3xA           LVELMKK-VDVVISALAVPQYLDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRR
2bd0A           HIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAA
2aqkA           EAIGAGNKLDGVVHAIGFMPQTGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDP
2a35B           -----------DGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLA----VGKRALEMGARHYLVVSA--L
3d5qB           AEQFVAQAGKLMGLNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-IVVVSSLAG
3d4nB           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-IVVVSSLAG
2e6gB           H-----APHFPAYRVRGTPADCVALGLH---LFGPVDLV---LSGVNLGS------NLGHEIWHSGTVAA
2ae2A           VANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSG
1e7wB           TAPVTWGRCDVLVNNASSFYPTPLREAMETATADLFGSNAIAPYAHRVAGTPAKHRGTNYSIINMVDAMT
3byzA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNG-SIVVVSSLAG
3d4nC           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNG-SIVVVSSLAG
1e92A           TAPAPVTLFTRCVNNASSFYPTPLLRNDGDREAMETATADLFGSNARVAGTPAKHRGTNYSIINMVDAMT
1bdmB           EATDDPD--VAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVALIAYKN
1b0aA           INRLENGKVVGDVVFEDAAKRASYITPVPG--GVGPMTVATLIENTLQACVEYHDPQ-------------
2bf7A           ACYTHWGRCDVLVNNASSFYPTPLLGDREAMETATADLFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMT
2bfoA           ACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATASNAIAPYFLIKAFAHAKHRGTNYSIINMVDAMT
3ctmD           VEETISQQEKDFGTIDVFVANAGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFKKNGKGSITSSISGKI
3ckyB           ----------------------------------------------------------------------
3bmnD           FRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMV
2b37B           AIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKLLPIMNPGGSIVGMDFDP
3dxfA           LNG-----AYATFIVTNYWECSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHF----
3e9qB           RIVVNYPRLDGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFLTQAL--LPLLLKSDAGSLVFTSSSVG
3d7lD           -----------IVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDKGSFTLTTGI----
2bfaA           ACYTHWGRCDVLVNNASSFYPTPLLRDRETATADLFGSNAIAPYFLIKAFAHRVHRGTNYSIINMVDAMT
2b36B           AIGAGNKLDGVVHSGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDP
3d4nD           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-IVVVSSLAG
2dt8A           ALEE-ADHVLSLHISGKLGTVQSAELAAQEFPGRVTDTQAASLGVGVLRAKELLEE--------------
2bfmB           ACYTHWGRCDVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAPAKHRGTNYSIINMVDAMT
2aq8A           AIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPINPGGSIVGMDFDP
3cxrA           QIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMS
2b4qA           ALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPARSVAGI
1ae1A           VAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAG
3bywA           ---STTETVERDVRPI----IGIYTELE------------------------------------------
2b35F           LAGRVTEAIDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASKALLPIMNPGGSIVGMDFDP
3ch6A           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVV-VSSLAG
2aqhA           EAIGAGNKLDGVVHSIGFMTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDP
2bfaB           ACYTHWGRCDVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAPAKHRGTNYSIINMVDAMT
2ef0A           TEKRLRDFQGFQVNGELLLPAHYGEETTEEAVHGPRSRVFDQAENRLHTAKAVLL---------------
2c29D           SFDEAIKGCTGVFHVATPMDFESKDPEN-----EVIKPTIEGMLGI----MKSCAAAKTVRRLVFTS---
2amfA           ----------------------------------------------------------------------
1d4gA           GRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGRRIILLAEGRLVNLGFTNQV
3bmqC           SCFRAFGRCDVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMV
1c14A           LGKVWPKFDGFVHSIGFQLDGDYVNAVTREGFKIAHDISSYSFVAMAKAC--RSMLNPGSALLTLSYLGA
3e9nC           ---------VDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAAS-----------G
2amfD           ----------------------------------------------------------------------
3ctmC           EETISQQEKDFGTIDVFVANAGVTWVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG
3c24A           ----------------------------------------------------------------------
3e9nB           EVLEEGGVDKLKNLDHVDTLV---HAASVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVI--------
2bfoC           ACYTHWGRCDVLVNNASSFYPTPLLRDREAMETATADLFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMT
1ek6B           QRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSVYGNPQYLPLDEA
1e3sA           GRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRASVAA
1buaA           YWRNYSQLRNDKYNNIS-----------------------------------------------------
2bfaC           CYTHWGRCDVLVNNSSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVHRGTNYSIINMVDAMT
2c0cA           LKQEYPEGVDVVYESVG-----------------------------------------------------
3ckyA           FT--------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2bfaD           ACYTHWGRCDVLVNNASSFYPTPLLRDRETATADLFGSNAIAPYFLIKAFAHRVHRGTNYSIINMVDAMT
1dohA           EAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQA
2amfE           ----------------------------------------------------------------------
3dbrG           LQELNSD-VSGSFVEESP----ENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYG
3e5mB           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
3d3eB           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNG-SIVVVSSLAG
3c85B           WERILDTGHVKLVLLAPHHQG---NQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAG
2bkaA           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
1ek5A           QRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLAHGVKNLVFSSSATVYGNPQYLPLDEA
3bmnC           SCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMV
1e6wB           GRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGINTASVAA
2amfC           ----------------------------------------------------------------------
2aefB           -----RGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQV------------
1e5lA           VAKHDLVISLIPYTFHATVIKSAIRQKKHVVT---TSYVSPAMMELDQAAKDAGITVMNE----------
3cxtA           QIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMS
3d5qA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVV-LTVAALPMLKQSNGSIVVVSSLAG
3bzuA           QAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNG-SIVVVSSLAG
3c24B           ----------------------------------------------------------------------
3dtdA           -----------ILVSKPVRQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRA-GKHLKLAMTIAAP
1e3jA           IRSAIGDLPNVTIDCSG-----------------------------------------------------
1a2zA           ---------EIVINLGLAPTYSNITVERIAVNIIDARIPDNDGYQP----IDEKIEEDAPLAYMATL---
2aejB           ----------------------------------------------------------------------
3dhnA           ----------------------------------------------------------------------
1dxyA           ----------------------------------------------------------------------
2cd9A           KDSVGKFDVIIDATGAD-----------------------------------------------------
3d7lB           KKYEQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDK--GSFTLTTGIED
3dnfB           LRACNGKGIVVTLEDI------------------------------------------------------
2ax3A           ILNEFDVVVDAIF---GTGLRGEITG--------------------------------------------
3dojA           IA--------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aw5A           EAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFD
1e7rA           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
2dbqA           ----------------------------------------------------------------------
1bg6A           ----------------------------------------------------------------------
3eeqB           AALLRDESICIDGINVN-----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
1a27A           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRF
3deyX           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTGSPEEVLDRT-----DIHTFHRFYQ
1dohB           AKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGENLSNEEVDEY
2ae1A           ALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQ--------------------
3ch6E           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGL--------------------------
2cnbB           IDINAKKSPESPYGESKLIAERMIRDCA------------------------------------------
3d3eA           KVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTET-----------------------
3dwfC           KITYPLIAPYSASKFALDGFFSTLRSEFLVNNVSITLCILGLIDTETAIKATSGI---------------
2ehdA           KNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGLKPEDVAQAVLF-----------------
3dwfA           KITYPLIAPYSASKFALDGFFSTLRSEFLVNNVSITLCILGLIDTETAIKATSGI---------------
3czrA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVS-----------------
1bmdA           APGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGN---------------------------
1a9zA           FPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDM--------------------
3ce6B           HPQIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEY--------------------
3d5qC           KVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAV------------------
2d1yA           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLE--------------------
1b8pA           APSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHS-------------------------
3bmoB           VDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPV-----------------------
2belC           KVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTET-----------------------
3edmB           DGGGPGALAYATSKGAVMTFTRGLAKEVGP----------------------------------------
3ctmF           KIVNIPQLAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITD---------------------
2cnbC           IDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDI------------------
3ce6A           HPSIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAE---------------------
3ce6D           HPSFVMSNSFANQNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKE--------------------
1c3vA           HHPHKADAPSGTAARTAKLIAEARKGLPPNPDA-------------------------------------
2d1yB           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIA--------------------------
3e48A           VRAYDPLKPYLPELNHKLIYPAGDGRINYITRNDIARGVIAIIKNPDTWGKRYLLSGYSYDKELAAILSE
1dfiA           ERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLMLAHCEAVT---------------
1bxkA           VYGDSTDDFFTETT--------------------------------------------------------
2b35A           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGAQI---------------------
2belA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSLCVLGLIDTETAMKAV------------------
3bzuB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSLCVLGLIDTETAMKAV------SGIVHMQAAPKE
2e37D           LLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARA-----------------------
3c2qA           ---------PSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG---------------------------
2cfcA           LVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQW--------------------
2d1yD           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEA-----------------------
1di7A           LPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVET-------------------------
3e9qA           RQGRANWGAYAASKFATEGQV---LADEYQQRLRVNCINPGGTRTARASA--------------------
3cq0B           RIMDFYKAYTAETDPGVLSVKKIYS-YYKRHGYATEVMAASFRNLDELKALAGIDNMTLPLNLLEQLYES
1dj2A           IAPSVVGDLIGVVKAYTTRVGSGPFPTTGGDLLRLAGQEFGTTTGRPRRC--------------------
2d1yC           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLE--------------------
2c29F           MEFCRAKKMTAWMYFVSKTLAEQA----------------------------------------------
3c2qB           ---------PSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG---------------------------
2ag5A           SVKGVVNRVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE--------------------
1bxkB           VDLHSTDDFFTETTYAPSSSDHLVRAWLRTYGLPTLITNCSNNYGPYHFP--------------------
1c9yA           -FYSPRSLVFPEAENRKWTIMAVMVSLLTDYSP-------------------------------------
2ehdB           KNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGSVKLKPEDV--------------------
2cnbA           NAKKSPESPYGESKLIAERMIRDCAEAYGIKGICL-----------------------------------
2eghA           DAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGS--------------------
2b35E           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAG-----------------------
3d3wA           QRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQA--------------------
2a4kA           AFGLAHYAAGKLGVVGL---ARTLALELARKGVRVNVLLPGLIQTPMTA---------------------
2a4kB           -----------TGKLGVVGLARTLALELARKGVRVNVLLPGLIQAWE-----------------------
3bmeC           VDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKW---------------------
3ch6B           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMK--------------------
3e03C           LNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATD-----------------------
3e03B           LNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATD-----------------------
2e37E           LLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAESPE-----------------------
2e37B           RALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALSPEDRARIDEGVRRAAYR
2a92C           SGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAH---------------------------
3e6vA           LDPSFTPAVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKT-------------------------
2dknA           EQQGQTHLAYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAV---------------------------
3dfzA           VLIHRLNVSKSRKHELLTEIIDDQRLSLVKQREFLQQI--------------------------------
2e6hB           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
1bdmA           APGLNPRNFTAMTRLDHNRAKAQLAKKT---GTGVDRIRRMTVWGNHSSIMF------------------
3bhmA           VRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWP-----------------------
1bsvA           GTLEPTNEPYAIAKIAGIKLCESYNRQYGDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAP
2dknB           EQQGQTHLAYAGSKYAVTCLARRNVVDWAGRGV-------------------------------------
3dtdB           G-----EPPLNDLFVQLNGFSNALNRLI------------------------------------------
2b4qB           ISAMGEQAYYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTR---------------------
1e7qA           GTLEPTNEPYAIAKIAGIKLCESYNRQYGDYRSVMPTNLYGPHDNFH-----------------------
1bhsA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRF
2belD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMK--------------------
1d0iA           VVAGCGVQGYVFGVERIAALA-------------------------------------------------
2ag5B           VKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPS-----------------------
2e6bD           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
3d5qD           KVAYPMVAAYSASKFALDGFFSSIRKEVSRVNVSITLCVLGLIDTETAMK--------------------
2c54B           AWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIGPFGTWKGGREKAPA---------------
2e6eD           VNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEEGTDRWAV---------------
2ag5C           VKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV---------------------------
2e6cD           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
2c5aB           AWPAEPQDAFGLEKLATEELCKHYNKDF------------------------------------------
2ekqD           AGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYEPITARI---------------
3dbhC           LVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDDMEDHSHTPWIVIIAKYLAQWYSET-N
2e37C           RVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPL-------------------------------------
2eezA           VLKLAEKGGLNTHKGRLTHPGVAEAFGL------------------------------------------
1e7sA           GTLEPTNEPYAIARIAGIKLCESYN---RQYGRDYRSVMPTNLYGPHDNF--------------------
3ek2A           ERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNA---------------------------------
1c9kB           MGIVPENRLARHFRDIAGRV----NQRLAAAADEVWLVVSGGVKIK------------------------
2e6gK           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
3edmC           DGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAV---------------------------------
3diiA           FQSEPDSEAYASAKGGIVALTHALAMSLGP-DVLVNCIAPGWI---------------------------
1edoA           LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTG-
2aw5B           PVTLPNGQTLYPGQGNNSYVF-------------------------------------------------
2c54A           AWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYG----------------------------
1c9kA           MGIVPENRLARHFRDIAGRVN----QRLAAAADEVWLVVSGGVKIK------------------------
2e6hC           AKQGYLFGLSAAAFSVPLNGE-------------------------------------------------
3dijA           FQSEPDSEAYASAKGGIVALTHALA-MSLGPDVLVNCIAPGWINVTFTQ---------------------
3d64A           HPSFVMSNELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDD--------------------
1cg3A           LGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGN----------------------------
1di6A           RKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCI---------------------------
3dxfB           FENLLSHFLPQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKMPE--------------------
3dwfB           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTETAIK--------------------
1cg1A           LGPRYVDYVLGILKAYSTRVG-------------------------------------------------
3donA           HQGAESFKIWTNLEPDIKAMKNIVIQKLKGELL-------------------------------------
2c5eA           AWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIGPFGTWKGGREAAPA---------------
3csdB           GGKQGVVHPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVET-------------------------
2c59B           AWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGP---------------------------
2dfdA           PITYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKT-----------------------
2c5eB           AWPAEPQDAYGLEKLATEELCKHYNKD-------------------------------------------
1dhrA           --GTPGMIGYGMAKGAVHQLCQSLAGKNSGMPSGAAAIAVLP----------------------------
3bywC           ----------------------------------------------------------------------
2ekpA           AGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLP--------------------
3dooA           HQGAESFKIWTNLEPDIKAMKNIVIQKLK-----------------------------------------
1dj3A           IAPRVIGDLIGVVKAYTTRVGSGPFPTEGDVLRKAGMEFGTTTGRPRRCGWLDI-VALKYCCDINGFSSL
3ch6D           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVN------------------------------------
1ahhA           ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDA-----------------------
2e6eB           FAGLR-----------------------------------------------------------------
3dfzB           VLIHRLNVSKSRKHELLTEIID------------------------------------------------
1a4iB           ------QSTVESAKRFLE----------------------------------------------------
3e03A           LNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATG-----------------------
3ek2D           ERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKSFG-----------------------
2a92B           SGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKM-----------------------
2e6cC           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
2axqA           DPGIDHLYAVKTIDEVHRAGGKLKSFLS------------------------------------------
3ctmH           IVNIPQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDF--------------------
3ek2B           ERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKFGK-----------------------
3d7lA           --IEDPIVQG-ASAAANGAVTAAKSAAIEPRGIRINTVSPNVLEESWDKL--------------------
3edmA           DGGGPGALAYATSKGAVMTFTRGLAKEVGP-KIRVNAVCPGMISTRE-----------------------
2aw5C           PVTLPNGQTLYPGQGN------------------------------------------------------
3edmD           DGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSSED--------------------------
2e6bC           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
1d7oA           RIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNI------------------------------------
1adeA           LGPRYVDYVLGILKAYSTRVG-------------------------------------------------
1a4iA           ----------------------------------------------------------------------
2bgkA           TAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTD--------------------
1cg4A           LGPRYVDYVLGILKAYSTRVGGPFPTELFDEFLCKQGNEFGATTGLRRRTGWLDTVAVRRAVQL--NSLS
2aqiA           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSA--------------------
2c5aA           AWPAEPQDAFGLEKLATEELCKHYNKDF------------------------------------------
2eggA           YQGALAFEKWTGQWPDVNRMKQLVIEALR-----------------------------------------
2c82A           -QIVPVDSEHSALAQCLRGGTPDEVAKL--VLTASGGPFRGWSAADLEHVTPEQAG--------------
2c59A           AWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGP---------------------------
1bw3A           ----------------------------------------------------------------------
3ctmG           --KIQLQAPYNTAKAAC-THLAKSLAIEWAPFARVNTISPGYIDTDITD---------------------
3c85C           ----------------------------------------------------------------------
3d5tC           APDLPKKNFTAMLRLDHNRALSQLAAKSGKPVASIEKLAWGNHSPTMYPDFRFATAE-------------
2cukA           ---PHIGSAGRTTRERMAEVAVENLLAVLEGREPPNP---------------------------------
2a92A           EHSGVPKNIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAH---------------------------
2bllA           GPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGP---------------------------
3bywB           ----------------------------------------------------------------------
2belB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
3bywD           ----------------------------------------------------------------------
3d3jA           EHAGRIYLCDIGIPQQV-----------------------------------------------------
3bywH           ----------------------------------------------------------------------
1civA           APNIPPKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWG----------------------------
2e6gA           AKQGYLFGLSAAAFSVPGEVPDFAGL--------------------------------------------
3c0bC           DIIPIVEGKVVAEKTDLERL--------------------------------------------------
3bywF           ----------------------------------------------------------------------
3ctmB           KIVNIPQLPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDIT-----------------------
2b35D           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEGWDQRAP--------------
1cwuA           RIIPGYGGGMSSAKAALESDTRVLAFEARKQNIRVNTISAGPLGSRAAKA--------------------
1bwsA           GTLEPTNEPYAIAKIAGIKLCESYN---RQYGRDYRSVMPTNLYGPHDNF--------------------
1e6uA           GTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSV-----------------------------------
3d3uA           LMGQAGQVDFLRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTGRNEVD--------------------
2b37C           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGE--------------------
2e6gG           ---AAKQGYLFGLSAAAFSVPLNGE---------------------------------------------
1cbuC           MGIV----PENRLARHFRDIAGRVNQRLAAAADEVWLVVSGGVKIK------------------------
3e48B           V---------------------------------------------------------------------
2b35C           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVA-------------------------------
2a35A           GADAKSSIFYNRVKGELEQALQEQG------WPQLTIARPSLLFGPREEFRLAEIL-----AAPIAGKYH
2e6hD           AKQGYLFGLSAAAFSVPLGEVPDFA---------------------------------------------
2e37A           LLAEYLRVAPQSVHAYVLGSEVLVWSSAQVGGVPLLEFA-------------------------------
3ctmE           --KIQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDIT-----------------------
3ctmA           GKIVQLQAPYNTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDITD---------------------
3ek2C           ERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNA---------------------------------
3bzuD           -VAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVS----------------------------------
2b35B           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGP----------------------------
3e5mA           ----------------------------------------------------------------------
3c6cA           IDGVPLFQVLGVLWGAPASTETIYQRNLIPANAQWAAFGIGRD---------------------------
3c3xA           ----------------------------------------------------------------------
2bd0A           TKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGK--------------------
2aqkA           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSA--------------------
2a35B           GADAKSSIFYNRVKGELEQALQEQGWP--QLTIARPSLLFGPREEFR-----------------------
3d5qB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
3d4nB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
2e6gB           AKQGYLFGLSAAAFSVPLNGEVPDFAGLR-----------------------------------------
2ae2A           ALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVI---------------------------
1e7wB           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDWEGHRSKVP--------------
3byzA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
3d4nC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSLCVLGLIDTETAMKAVSGIMQAAPKEECALEIIK
1e92A           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
1bdmB           APGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGN---------------------------
1b0aA           ----------------------------------------------------------------------
2bf7A           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
2bfoA           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
3ctmD           VNIPQLQAPYNTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDI-----------------------
3ckyB           ----------------------------------------------------------------------
3bmnD           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASA
2b37B           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEG-----------------------
3dxfA           ----------------------------------------------------------------------
3e9qB           RQGRANWGAYAASKFATEGQ---VLADEYQQRLRVNCINPGGTRTARASA--------------------
3d7lD           ---EDPIVQG-ASAAANGAVTAAKSAAIEPRGIRINTVSPNVLEESWD----------------------
2bfaA           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
2b36B           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPI---------------------------
3d4nD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMK--------------------
2dt8A           ----------------------------------------------------------------------
2bfmB           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
2aq8A           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQ-IQLLEE
3cxrA           ELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQ-----------------------
2b4qA           SAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRH--------------------
1ae1A           FSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQKE-----------------------
3bywA           ----------------------------------------------------------------------
2b35F           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQI-----------------------
3ch6A           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
2aqhA           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEG
2bfaB           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
2ef0A           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4gA           MAQIELWTHPDKYPVGVHFLPK----KLDEAVAEAHLGKLNVKLTKLTEK--------------------
3bmqC           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1c14A           ERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLA-----------------------
3e9nC           CVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPEPKEI-----------------------
2amfD           ----------------------------------------------------------------------
3ctmC           KIQLQAPYNTAKAACTH---LAKSLAIEWAPFARVNTISPGYI---------------------------
3c24A           ----------------------------------------------------------------------
3e9nB           ---YINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPIEPKEIANA---------------------
2bfoC           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDGH---------------------
1ek6B           HPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVL-----------------------------------
1e3sA           FEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVP--------------------
1buaA           ----------------------------------------------------------------------
2bfaC           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
2c0cA           ----------------------------------------------------------------------
3ckyA           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2bfaD           NQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------------------------
1dohA           KAVPKHA-VYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGENLSNEEVDEY
2amfE           ----------------------------------------------------------------------
3dbrG           LVGYMRIIIKEHPVI-------------------------------------------------------
3e5mB           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
3d3eB           KVAYPMVAAYSASKFALDGFFSSIRKEVSRVNVSITLCVLGLIDTETAMKAVSGIVQAAPKEECALEIIK
3c85B           S---------------------------------------------------------------------
2bkaA           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
1ek5A           HPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTG---------------------------
3bmnC           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASA
1e6wB           FEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPL-----------------------
2amfC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1e5lA           ----------------------------------------------------------------------
3cxtA           ELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTH---------------------
3d5qA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVS----------------------------------
3bzuA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVL----------------------------
3c24B           ----------------------------------------------------------------------
3dtdA           G-----EPPLNDLFVQLNGFSNALN---------------------------------------------
1e3jA           ----------------------------------------------------------------------
1a2zA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
3dhnA           ----------------------------------------------------------------------
1dxyA           ----------------------------------------------------------------------
2cd9A           ----------------------------------------------------------------------
3d7lB           PIVQGASAAANGAVTAF-----AKSAAIEPRGIRINTV--------------------------------
3dnfB           ----------------------------------------------------------------------
2ax3A           ----------------------------------------------------------------------
3dojA           ----------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aw5A           PVTLPNGQTLYPGQG-------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
2dbqA           ----------------------------------------------------------------------
1bg6A           ----------------------------------------------------------------------
3eeqB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTxxxxxxxxxx
1a27A           YQYLAHSKQVFREAAPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPS----------
3deyX           YL---AHSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPS----------
1dohB           AAVQWSP---------------------------------------------------------
2ae1A           ----------------------------------------------------------------
3ch6E           ----------------------------------------------------------------
2cnbB           ----------------------------------------------------------------
3d3eA           ----------------------------------------------------------------
3dwfC           ----------------------------------------------------------------
2ehdA           ----------------------------------------------------------------
3dwfA           ----------------------------------------------------------------
3czrA           ----------------------------------------------------------------
1bmdA           ----------------------------------------------------------------
1a9zA           ----------------------------------------------------------------
3ce6B           ----------------------------------------------------------------
3d5qC           ----------------------------------------------------------------
2d1yA           ----------------------------------------------------------------
1b8pA           ----------------------------------------------------------------
3bmoB           ----------------------------------------------------------------
2belC           ----------------------------------------------------------------
3edmB           ----------------------------------------------------------------
3ctmF           ----------------------------------------------------------------
2cnbC           ----------------------------------------------------------------
3ce6A           ----------------------------------------------------------------
3ce6D           ----------------------------------------------------------------
1c3vA           ----------------------------------------------------------------
2d1yB           ----------------------------------------------------------------
3e48A           ASGTEIKYEPVSLETFAEYDEPKGFGALLASYHALLDSNDFKDQPQTLQSFL------------
1dfiA           ----------------------------------------------------------------
1bxkA           ----------------------------------------------------------------
2b35A           ----------------------------------------------------------------
2belA           ----------------------------------------------------------------
3bzuB           ECALEIIKGGALRQEEV-----------------------------------------------
2e37D           ----------------------------------------------------------------
3c2qA           ----------------------------------------------------------------
2cfcA           ----------------------------------------------------------------
2d1yD           ----------------------------------------------------------------
1di7A           ----------------------------------------------------------------
3e9qA           ----------------------------------------------------------------
3cq0B           TD--------------------------------------------------------------
1dj2A           ----------------------------------------------------------------
2d1yC           ----------------------------------------------------------------
2c29F           ----------------------------------------------------------------
3c2qB           ----------------------------------------------------------------
2ag5A           ----------------------------------------------------------------
1bxkB           ----------------------------------------------------------------
1c9yA           ----------------------------------------------------------------
2ehdB           ----------------------------------------------------------------
2cnbA           ----------------------------------------------------------------
2eghA           ----------------------------------------------------------------
2b35E           ----------------------------------------------------------------
3d3wA           ----------------------------------------------------------------
2a4kA           ----------------------------------------------------------------
2a4kB           ----------------------------------------------------------------
3bmeC           ----------------------------------------------------------------
3ch6B           ----------------------------------------------------------------
3e03C           ----------------------------------------------------------------
3e03B           ----------------------------------------------------------------
2e37E           ----------------------------------------------------------------
2e37B           II---EGKGATYYGIGAGLARLVRAILTDE----------------------------------
2a92C           ----------------------------------------------------------------
3e6vA           ----------------------------------------------------------------
2dknA           ----------------------------------------------------------------
3dfzA           ----------------------------------------------------------------
2e6hB           ----------------------------------------------------------------
1bdmA           ----------------------------------------------------------------
3bhmA           ----------------------------------------------------------------
1bsvA           DV--------------------------------------------------------------
2dknB           ----------------------------------------------------------------
3dtdB           ----------------------------------------------------------------
2b4qB           ----------------------------------------------------------------
1e7qA           ----------------------------------------------------------------
1bhsA           YQYLAHSKQVFRENPE-EVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPS----------
2belD           ----------------------------------------------------------------
1d0iA           ----------------------------------------------------------------
2ag5B           ----------------------------------------------------------------
2e6bD           ----------------------------------------------------------------
3d5qD           ----------------------------------------------------------------
2c54B           ----------------------------------------------------------------
2e6eD           ----------------------------------------------------------------
2ag5C           ----------------------------------------------------------------
2e6cD           ----------------------------------------------------------------
2c5aB           ----------------------------------------------------------------
2ekqD           ----------------------------------------------------------------
3dbhC           GRIPKTYKEKEDFRD-------------------------------------------------
2e37C           ----------------------------------------------------------------
2eezA           ----------------------------------------------------------------
1e7sA           ----------------------------------------------------------------
3ek2A           ----------------------------------------------------------------
1c9kB           ----------------------------------------------------------------
2e6gK           ----------------------------------------------------------------
3edmC           ----------------------------------------------------------------
3diiA           ----------------------------------------------------------------
1edoA           ----------------------------------------------------------------
2aw5B           ----------------------------------------------------------------
2c54A           ----------------------------------------------------------------
1c9kA           ----------------------------------------------------------------
2e6hC           ----------------------------------------------------------------
3dijA           ----------------------------------------------------------------
3d64A           ----------------------------------------------------------------
1cg3A           ----------------------------------------------------------------
1di6A           ----------------------------------------------------------------
3dxfB           ----------------------------------------------------------------
3dwfB           ----------------------------------------------------------------
1cg1A           ----------------------------------------------------------------
3donA           ----------------------------------------------------------------
2c5eA           ----------------------------------------------------------------
3csdB           ----------------------------------------------------------------
2c59B           ----------------------------------------------------------------
2dfdA           ----------------------------------------------------------------
2c5eB           ----------------------------------------------------------------
1dhrA           ----------------------------------------------------------------
3bywC           ----------------------------------------------------------------
2ekpA           ----------------------------------------------------------------
3dooA           ----------------------------------------------------------------
1dj3A           NLTKLDVLSGL-PEIKLGVSYN------QMDGEKLQSFPGDLDTLEQVQVNYEV----------
3ch6D           ----------------------------------------------------------------
1ahhA           ----------------------------------------------------------------
2e6eB           ----------------------------------------------------------------
3dfzB           ----------------------------------------------------------------
1a4iB           ----------------------------------------------------------------
3e03A           ----------------------------------------------------------------
3ek2D           ----------------------------------------------------------------
2a92B           ----------------------------------------------------------------
2e6cC           ----------------------------------------------------------------
2axqA           ----------------------------------------------------------------
3ctmH           ----------------------------------------------------------------
3ek2B           ----------------------------------------------------------------
3d7lA           ----------------------------------------------------------------
3edmA           ----------------------------------------------------------------
2aw5C           ----------------------------------------------------------------
3edmD           ----------------------------------------------------------------
2e6bC           ----------------------------------------------------------------
1d7oA           ----------------------------------------------------------------
1adeA           ----------------------------------------------------------------
1a4iA           ----------------------------------------------------------------
2bgkA           ----------------------------------------------------------------
1cg4A           GF-CLTKLDVLDGLKEVKLC--------------------------------------------
2aqiA           ----------------------------------------------------------------
2c5aA           ----------------------------------------------------------------
2eggA           ----------------------------------------------------------------
2c82A           ----------------------------------------------------------------
2c59A           ----------------------------------------------------------------
1bw3A           ----------------------------------------------------------------
3ctmG           ----------------------------------------------------------------
3c85C           ----------------------------------------------------------------
3d5tC           ----------------------------------------------------------------
2cukA           ----------------------------------------------------------------
2a92A           ----------------------------------------------------------------
2bllA           ----------------------------------------------------------------
3bywB           ----------------------------------------------------------------
2belB           ----------------------------------------------------------------
3bywD           ----------------------------------------------------------------
3d3jA           ----------------------------------------------------------------
3bywH           ----------------------------------------------------------------
1civA           ----------------------------------------------------------------
2e6gA           ----------------------------------------------------------------
3c0bC           ----------------------------------------------------------------
3bywF           ----------------------------------------------------------------
3ctmB           ----------------------------------------------------------------
2b35D           ----------------------------------------------------------------
1cwuA           ----------------------------------------------------------------
1bwsA           ----------------------------------------------------------------
1e6uA           ----------------------------------------------------------------
3d3uA           ----------------------------------------------------------------
2b37C           ----------------------------------------------------------------
2e6gG           ----------------------------------------------------------------
1cbuC           ----------------------------------------------------------------
3e48B           ----------------------------------------------------------------
2b35C           ----------------------------------------------------------------
2a35A           GIEACDLARALW-RLALEEGKGVRFVESDEL----RKLGKGS----------------------
2e6hD           ----------------------------------------------------------------
2e37A           ----------------------------------------------------------------
3ctmE           ----------------------------------------------------------------
3ctmA           ----------------------------------------------------------------
3ek2C           ----------------------------------------------------------------
3bzuD           ----------------------------------------------------------------
2b35B           ----------------------------------------------------------------
3e5mA           ----------------------------------------------------------------
3c6cA           ----------------------------------------------------------------
3c3xA           ----------------------------------------------------------------
2bd0A           ----------------------------------------------------------------
2aqkA           ----------------------------------------------------------------
2a35B           ----------------------------------------------------------------
3d5qB           ----------------------------------------------------------------
3d4nB           ----------------------------------------------------------------
2e6gB           ----------------------------------------------------------------
2ae2A           ----------------------------------------------------------------
1e7wB           ----------------------------------------------------------------
3byzA           ----------------------------------------------------------------
3d4nC           GGALR-----------------------------------------------------------
1e92A           ----------------------------------------------------------------
1bdmB           ----------------------------------------------------------------
1b0aA           ----------------------------------------------------------------
2bf7A           ----------------------------------------------------------------
2bfoA           ----------------------------------------------------------------
3ctmD           ----------------------------------------------------------------
3ckyB           ----------------------------------------------------------------
3bmnD           EQIAD-----------------------------------------------------------
2b37B           ----------------------------------------------------------------
3dxfA           ----------------------------------------------------------------
3e9qB           ----------------------------------------------------------------
3d7lD           ----------------------------------------------------------------
2bfaA           ----------------------------------------------------------------
2b36B           ----------------------------------------------------------------
3d4nD           ----------------------------------------------------------------
2dt8A           ----------------------------------------------------------------
2bfmB           ----------------------------------------------------------------
2aq8A           GWDQRAPIGWNMKDAT-PVAKTVCALLSDWLP----ATTGDIIYA-------------------
3cxrA           ----------------------------------------------------------------
2b4qA           ----------------------------------------------------------------
1ae1A           ----------------------------------------------------------------
3bywA           ----------------------------------------------------------------
2b35F           ----------------------------------------------------------------
3ch6A           ----------------------------------------------------------------
2aqhA           WDQRAPIGW-------------------------------------------------------
2bfaB           ----------------------------------------------------------------
2ef0A           ----------------------------------------------------------------
2c29D           ----------------------------------------------------------------
2amfA           ----------------------------------------------------------------
1d4gA           ----------------------------------------------------------------
3bmqC           ----------------------------------------------------------------
1c14A           ----------------------------------------------------------------
3e9nC           ----------------------------------------------------------------
2amfD           ----------------------------------------------------------------
3ctmC           ----------------------------------------------------------------
3c24A           ----------------------------------------------------------------
3e9nB           ----------------------------------------------------------------
2bfoC           ----------------------------------------------------------------
1ek6B           ----------------------------------------------------------------
1e3sA           ----------------------------------------------------------------
1buaA           ----------------------------------------------------------------
2bfaC           ----------------------------------------------------------------
2c0cA           ----------------------------------------------------------------
3ckyA           ----------------------------------------------------------------
2eggB           ----------------------------------------------------------------
2bfaD           ----------------------------------------------------------------
1dohA           AAVQW-----------------------------------------------------------
2amfE           ----------------------------------------------------------------
3dbrG           ----------------------------------------------------------------
3e5mB           ----------------------------------------------------------------
2c20A           ----------------------------------------------------------------
3d3eB           GGALR-----------------------------------------------------------
3c85B           ----------------------------------------------------------------
2bkaA           ----------------------------------------------------------------
1arzB           ----------------------------------------------------------------
1ek5A           ----------------------------------------------------------------
3bmnC           EQIAD-----------------------------------------------------------
1e6wB           ----------------------------------------------------------------
2amfC           ----------------------------------------------------------------
2aefB           ----------------------------------------------------------------
1e5lA           ----------------------------------------------------------------
3cxtA           ----------------------------------------------------------------
3d5qA           ----------------------------------------------------------------
3bzuA           ----------------------------------------------------------------
3c24B           ----------------------------------------------------------------
3dtdA           ----------------------------------------------------------------
1e3jA           ----------------------------------------------------------------
1a2zA           ----------------------------------------------------------------
2aejB           ----------------------------------------------------------------
3dhnA           ----------------------------------------------------------------
1dxyA           ----------------------------------------------------------------
2cd9A           ----------------------------------------------------------------
3d7lB           ----------------------------------------------------------------
3dnfB           ----------------------------------------------------------------
2ax3A           ----------------------------------------------------------------
3dojA           ----------------------------------------------------------------
1db3A           ----------------------------------------------------------------
2aemA           ----------------------------------------------------------------
2aw5A           ----------------------------------------------------------------
1e7rA           ----------------------------------------------------------------
3eheA           ----------------------------------------------------------------
2aefA           ----------------------------------------------------------------
2b69A           ----------------------------------------------------------------
2dbqA           ----------------------------------------------------------------
1bg6A           ----------------------------------------------------------------
3eeqB           ----------------------------------------------------------------