[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30394.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c4bA.bssp"
#ERROR : Can't open dsspfile "2a11A.bssp"
#ERROR : Can't open dsspfile "2eb1C.bssp"
#ERROR : Can't open dsspfile "2eb1A.bssp"
#ERROR : Can't open dsspfile "2eb1B.bssp"
#ERROR : Can't open dsspfile "3c4tA.bssp"
#ERROR : Can't open dsspfile "2cpnA.bssp"
#ERROR : Can't open dsspfile "2dixA.bssp"
#ERROR : Can't open dsspfile "1di2A.bssp"
#ERROR : Can't open dsspfile "2b7tA.bssp"
#ERROR : Can't open dsspfile "2dmyA.bssp"
#ERROR : Can't open dsspfile "1ekzA.bssp"
#ERROR : Can't open dsspfile "2b7vA.bssp"
#ERROR : Can't open dsspfile "1di2B.bssp"

## Summary of PDB Search
:230
    1e-34  27%  3c4bA  [x.x.x] ENDORIBONUCLEASE DICER
    2e-34  36%  2a11A  [x.x.x] RIBONUCLEASE III
    3e-33  34%  2eb1C  [x.x.x] ENDORIBONUCLEASE DICER
    5e-33  34%  2eb1A  [x.x.x] ENDORIBONUCLEASE DICER
    2e-31  34%  2eb1B  [x.x.x] ENDORIBONUCLEASE DICER
    4e-14  31%  3c4tA  [x.x.x] ENDORIBONUCLEASE DICER
    1e-11  30%  2cpnA  [x.x.x] TAR RNA-BINDING PROTEIN 2
    8e-10  28%  2dixA  [x.x.x] INTERFERON-INDUCIBLE DOUBLE STRANDED RNA-
    2e-09  29%  1di2A  [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A
    3e-09  20%  2b7tA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1
    4e-09  19%  2dmyA  [x.x.x] SPERMATID PERINUCLEAR RNA-BINDING PROTEIN
    1e-08  21%  1ekzA  [d.50.1] MATERNAL EFFECT PROTEIN (STAUFEN)
    7e-07  19%  2b7vA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1
    2e-06  32%  1di2B  [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
3c4bA           LISGFETFEKKINYRFKNKAYLLQAFTHASNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2a11A           ------PLLDALGVDLPD-ELLSLALTHRSGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKL
2eb1C           LISGFENFEKKINYRFKNKAYLLQAFTHASYITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2eb1A           LISGFENFEKKINYRFKNKAYLLQAFTHASYHYDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2eb1B           LISGFENFEKKINYRFKNKAYLLQAFTHASYHYDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
3c4tA           ------TFEKKINYRFKNKAYLLQAFTHASYHYNDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2cpnA           ----------------------------------------------------------------------
2dixA           ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------
2b7tA           ----------------------------------------------------------------------
2dmyA           ----------------------------------------------------------------------
1ekzA           ----------------------------------------------------------------------
2b7vA           ----------------------------------------------------------------------
1di2B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
3c4bA           RSALVNNTIFASLAVKYDYHKYFKAVSPENEEDIEVPKAGDIFESLAGAIYDSGSLEVVWQVYYPQPLIE
2a11A           RASVVNTQALADVARRLCAEGLGVRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPL
2eb1C           RSALVNNTIFASLAVKYDYHKYFKAVSPEKEDIEVPKAMGDIFESLAGAIYMDSSLETVWQVYYPMMRPL
2eb1A           RSALVNNTIFASLAVKYDYHKYFKAVSPEKEDIEVPKAMGDIFESLAGAIYMDSSLETVWQVYYPMMRPL
2eb1B           RSALVNNTIFASLAVKYDYHKYFKAVSPEKEDIEVPKAMGDIFESLAGAIYMDSSLETVWQVYYPMMRPL
3c4tA           RSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIVPKAMGDIFESLAGAIYMDSSLEVVWQVYYPMMQPL
2cpnA           ----------------------------------------------------------------------
2dixA           ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------
2b7tA           ----------------------------------------------------------------------
2dmyA           ----------------------------------------------------------------------
1ekzA           ----------------------------------------------------------------------
2b7vA           ----------------------------------------------------------------------
1di2B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
3c4bA           KFSANVP---RSPVRELLEEPETAKFSPAERT---------YDGKVR-VTVEVVGKGKFKGVGRSYRIAK
2a11A           LDAAP-----------------------------------------------------------------
2eb1C           IEKFS-----------------------------------------------------------------
2eb1A           IEKFSA----------------------------------------------------------------
2eb1B           IEKFS-----------------------------------------------------------------
3c4tA           IEKFSAN--VPRSPVRELLEMEPETAKFSPAERTYDGKVR-----VTVEVVGKG---KFKGVGRSYRIAK
2cpnA           -----------CNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVER--FIEIGSGTSKKLAK
2dixA           -----------KTPIQVLHEYGMKTKNI-PVYECERSDVQIHVPTFTFRVTVGDI--TCTGEGTSKKLAK
1di2A           --------------VGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVET--FVETGSGTSKQVAK
2b7tA           ---------GPVLPKNALMQLNEIK--PGLQYMLLSQTGPVHAPLFVMSVEVNGQVFE--GSGPTKKKAK
2dmyA           ---------KAIDLMNALMRLNQIR--PGLQYKLLSQSGPVHAPVFTMSVDVDGT--TYEASGPSKKTAK
1ekzA           -----MDEGDKKSPISQVHEIGIKRNMT-VHFKVLREEGPAHMKNFITACIVGSI--VTEGEGNGKKVSK
2b7vA           -----------KNPVMILNELRPG-----LKYDFLSESGESHAKSFVMSVVVDGQFFE--GSGRNKKLAK
1di2B           --------------VGSLQELAVQKGWRLPEY---------TVAQFTITCRVETF--VETGSGTSKQVAK


                         .         .         .         +         .         .         .:280
query           QKTAEKMIEMLSQQGLHEKK
3c4bA           SAAARRALRSL---------
2a11A           --------------------
2eb1C           --------------------
2eb1A           --------------------
2eb1B           --------------------
3c4tA           SAAARRALRSL---------
2cpnA           RNAAAKMLLRVSGP------
2dixA           HRAAEAAINILKANAS----
1di2A           RVAAEKLLTKF---------
2b7tA           LHAAEKAL------------
2dmyA           LHVAVKVLQAMGYPTGFDAD
1ekzA           KRAAEKMLVEL---------
2b7vA           ARAAQSALATV---------
1di2B           RVAAEKLLTKF---------