[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2akeA.bssp"
#ERROR : Can't open dsspfile "2cyaA.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "2ar9A.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"

## Summary of PDB Search
:334
    2e-50  16%  2akeA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    8e-44  21%  2cyaA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    2e-42  22%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    9e-40  23%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-37  21%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-34  32%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    5e-32  22%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    9e-26  17%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    1e-24  19%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    5e-18  13%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-17   9%  2ar9A  [x.x.x] CASPASE-9
    6e-10  13%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    2e-04  12%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-04  12%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    5e-04  15%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
2akeA           ---FYLYTGRGPSSEAHVGHLIPFIFTKWLQ-DVFNVPLVIQMTDDEKYLKDLTLDQAYSYAVENAKDII
2cyaA           ----KGYIGYEPSGVAHIGWLVWMYK--VKDLVEAGVDFSVLEATWHAYIKLGGDMDLIRAAARIVRRME
3d6uA           ---KSAIIGFEPSGKIHLGHYLQIKKMIDLQ--NAGFDIIILLADLFAYLNQKELDEIRKIGDYNKKVFE
2cybA           --KPRAYVGYEPSGEIHLGHMMTVQKLMDLQ--EAGFEIIVLLADIHAYLNEKGTFEEAEVADYNKKVFI
3d6vA           ---KSAIIGFEPSGKIHLGHYLQIKKMIDLQ--NAGFDIIILLADLFAYLNQKELDEIRKIGDYNKKVFE
1d2rA           ---KTIFSGIQPSGVITIGNYIGALRQFVELQ--HEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2cybB           --KPRAYVGYEPSGEIHLGHMMTVQKLMDLQEAG--FEIIVLLADIHAYLNEKGTFEEAEVADYNKKVFI
2dlcX           ----KLYWGTAPTGRPHCGYFVPMTKLADFLKAG--CEVTVLLADLHAFLDNMKAPRAKYYELTIKAILR
2ag6A           ---KSALIGFEPSGKIHLGHYLQIKKMIDLQNAG--FDIIILLADLHAYLQKGELDEIRKIGDYNKKVFE
2azxA           ----YLYTGRGPSSEAHVGHLIPFIFTKWLQDVF--NVPLVIQTDDEKYLWDLTLDQAYGDAVENAKDII
2ar9A           ---------VEVKGDLTAKKMVLALLELARQDHGA-LDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSV
2cycA           ----QHYIGFEISGYIHLGTGLMAGAKIADFQKAG-IKTRVFLADWHSWINDKLGDLEVIQEVALKYFKV
1a8hA           MEKVFYVTTPIYNAEPHLGHAYTTVADFLARWHRLDGYRLTGTDEHGETVGEDPKAFVDRVSGRFKRAWD
2d54A           MEKVFYVTTPIYNAEPHLGHAYTTVADFLARWHRLDGYRLTGTDEHGETVGEDPKAFVDRVSGRFKRAWD
2cfoA           ----------SPTGNLHIGTARTAVFNWLYARHRGGKFILRI-------EDTDRERSRPEYTENILEGLQ


                         .         .         *         .         .         .         .:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
2akeA           ACGFDINKTFIFSDLD--YMGMSSGFYKNVVKIQKHVTFNQVKGIFGFT---------DSDCIGKISFPA
2cyaA           AAGVPVERVRFVDAEELASDKDYWGLVIRVAKRASLARVR--RALAEE----------AEVDASKLIYPL
3d6uA           AMGLKAKY---VYGSSFMLDKDYTLNVYRLALKTTLKRARRSMELIARE--------DENPKVAEVIYPI
2cybA           ALGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRARRSMDEVSRR--------KEDPMVSQMIYPL
3d6vA           AMGLKAKY---VYGSSFMLDKDYTLNVYRLALKTTLKRARRSMELIARE--------DENPKVAEVIYPI
1d2rA           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSAGAAAAAAGLLTYPP
2cybB           ALGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRARRSMDEVSRRKED--------PMVSQMIYPL
2dlcX           SINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGA--------DVVKQVANPLLSGLIYPL
2ag6A           AMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELI-----------AREDENPKVAEVIYPI
2azxA           ACGFDINKTFIFSDLDYGSSGFYKNVV-------------KIQKHVTFNQVKGIFGFTDSDCIGKISFPA
2ar9A           EKIVNIFNGTSCPS--LGGKPKLFFIQASLPTPSDIFVSYSTFPGFVSDPKSGSWYVETLDDIFEQWAHS
2cycA           GMEKSIEVMGGDPKKVEFVLASEILEKGDYWQTVIDISKNVTLSRVMRSITIMGRQMGEAIDFAKLIYPM
1a8hA           LLGIAYDDFIRTTEERHKKVVQL-------VLKKVYEAGDIYYGEYEGLYCVS-----------------
2d54A           LLGIAYDDFIRTTEERHKKVVQL-------VLKKVYEAGDIYYGEYEGL---------------------
2cfoA           WLGLTWDEGPYFQSDRLDLYRQAIQ---------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
2akeA           IQAAPSFSNSFPLIPCAIDQDPYFRMTRDVAPRIGY-------PKPALLHSTFFPALQGAQTKMSASDPN
2cyaA           MQVSDIFYMDLDIALGGMDQRKAHMLARDVAEKLGRKKPVAIH----------TPIISSLQGPKMSKSKP
3d6uA           MQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVL--------------TGLDGGKMSSSKG
2cybA           MQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGYSSPV-CLHTPI---------LVGLDGQKMSSSKG
3d6vA           MQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVL--------------TGLDGEGMSSSKG
1d2rA           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGEFTIPEARIPKVGARIMSLVDPTKKMSKSDP
2cybB           MQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGYSSPVCLH----------TPILVGLDGQKMSSSKG
2dlcX           MQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRA-HLMNPMVPGLANSKIDLLEEPKKINSAFC
2ag6A           MQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLD-------------GEGKMSSSKG
2azxA           IQAAPSFSNSFPQIF--RDRTDIQCLIPCAIDQDPYFRTRDVAPRIGYPKPALFFPALQGAQTKSASDPN
2ar9A           EDLQSLLLRVANAVSVKGIYKQMPCIVSMLRKKLF-----------------------------------
2cycA           MQVADIFYQGVTIAHAGMDQRKAHVIAIEVAQKLRYHPIVHEGEKLKPVAVHHHLLLGLQEPPKWPIESE
1a8hA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
2akeA           SSIFLTDTAKQIKTKVNKHAFSGGRDEHRQFGGNCDVDVSFMFLEDDDKLEQIRKDYTSGAMLTGELKKA
2cyaA           ETAVFVDIRRKIRKAYKQVQGNPVLEIARYILFARDGFTLRVDV-EYTSYEELERDYTDGRLHPLDLKNA
3d6uA           NFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPGDLTVNSYEELESLFKNKELHPMDLKNA
2cybA           NYISVRDPPEEVERKIRKAYCPAGVVEENPILDIYHILPRFGGDVEYASFEELAEDFKSGQLHPLDLKIA
3d6vA           NFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPGDLTVNSYEELESLFKNKELHPMDLKNA
1d2rA           NYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSSGQSIEELERQY--EGKGYGVFKAD
2cybB           NYISVRDPPEEVERKIRKAYCPAGVVEENPILDGKIVVERDAGDVEYASFEELAEDFKSGQLHPLDLKIA
2dlcX           SPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIG
2ag6A           NFIAVDDSPEEIRAKIKKAYCPAG--VVEGNPIMEIAKYFFGGDLTVNSYEELESLFKNKELHPMDLKNA
2azxA           SSIFLTDTAKQIKTKVNKHAFSGGRDTIEGNCDVDVSFYLTFFLEDDDKLEQIRKDYTSGA-LTGELKKA
2ar9A           ----------------------------------------------------------------------
2cycA           EEFKEIKAQMKMSKSKPYSAVFIHDSIIFREEPTEFTVHRPAKFGGDTTFEELKRDFAEGKLHPLDLKNA
1a8hA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
2akeA           LIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSF-------------------
2cyaA           VAESLIEVVRPIRGAVLGDPAMKRALEAIEGK----------------------
3d6uA           VAEELIKILEPIRKRL--------------------------------------
2cybA           VAKYLNMLLEDARKRL--------------------------------------
3d6vA           VAEELIKILEPIRKRLLEH-----------------------------------
1d2rA           LAQVVIETLRPIQERYHHWMESEE-LDRVLDEGAEKANRVASEMVRKMEQAMGL
2cybB           VAKYLNMLLEDARKRL--------------------------------------
2dlcX           VADAINELLEPIRQEF----ANNKEFQEASEKG---------------------
2ag6A           VAEELIKILEPIRKRL--------------------------------------
2azxA           LIEVLQPLIAEHQARRKEVTDEIVKEFTPRKLS---------------------
2ar9A           ------------------------------------------------------
2cycA           VAEYLINLLEPIRRYFEKHPEPLELMRSV-------------------------
1a8hA           ------------------------------------------------------
2d54A           ------------------------------------------------------
2cfoA           ------------------------------------------------------