[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30480.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cweA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2cfxA.bssp"
#ERROR : Can't open dsspfile "2d1hA.bssp"
#ERROR : Can't open dsspfile "3cuoC.bssp"
#ERROR : Can't open dsspfile "2efqA.bssp"
#ERROR : Can't open dsspfile "3cuoA.bssp"
#ERROR : Can't open dsspfile "2dbbA.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "2e7wA.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "3boqA.bssp"
#ERROR : Can't open dsspfile "2a61A.bssp"
#ERROR : Can't open dsspfile "2d1hB.bssp"
#ERROR : Can't open dsspfile "2efoA.bssp"
#ERROR : Can't open dsspfile "2dbbB.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"
#ERROR : Can't open dsspfile "2dk5A.bssp"
#ERROR : Can't open dsspfile "2eb7A.bssp"
#ERROR : Can't open dsspfile "2co5A.bssp"
#ERROR : Can't open dsspfile "2co5B.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"

## Summary of PDB Search
:121
    2e-09  16%  2cweA  [x.x.x] HYPOTHETICAL TRANSCRIPTION REGULATOR PROTEIN,
    2e-09  10%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    2e-08  13%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    3e-08   8%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    1e-07  21%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-07  13%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    4e-07  14%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-06  13%  2cfxA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
    1e-06  21%  2d1hA  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-06  21%  3cuoC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-06  23%  2efqA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    3e-06  21%  3cuoA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-06  12%  2dbbA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    4e-06  14%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    6e-06  25%  2e7wA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    7e-06  11%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    1e-05  14%  3boqA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    1e-05  20%  2a61A  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    1e-05  20%  2d1hB  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-05  25%  2efoA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    3e-05  14%  2dbbB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    6e-05  15%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    8e-05  24%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    1e-04  14%  2dk5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    1e-04  13%  2eb7A  [x.x.x] 146AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-04  15%  2co5A  [x.x.x] VIRAL PROTEIN F93
    3e-04  11%  2co5B  [x.x.x] VIRAL PROTEIN F93
    4e-04  11%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    7e-04  13%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    7e-04  13%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    8e-04  13%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
2cweA           VKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNY
1bibA           --------------NTVPLKLIALLANGEHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKYSLP
3bp8A           -----------QIKQTNAGAVYRLIDQLGVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVG-----
3bp8B           ------------IKQTNAGAVYRLIDQLGVSRIDLSRLAQLAPASITKIVREMLEAHLVQELVGLVVETE
3cuoD           ----------KAMSHPKRLLILCMLSGSPTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILY
1biaA           ------------KDNTVPLKLIALLANGEHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGK----
2b0lA           ----------YSELEAIEHIFEELDGNEGLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTY
2cfxA           ------------KLDQIDLNIIEELKKDSLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKK
2d1hA           ESKKDEIRCCYKITDTDVAVLLKVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPK----
3cuoC           ----------KAMSHPKRLLILCMLSGSPTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILY
2efqA           --------------DEIDLRILKILQYNAYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPAS
3cuoA           ----------KAMSHPKRLLILCMLSGSPTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILY
2dbbA           --------------DRVDMQLVKILSENSLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPSKVP
2cg4A           --------------DNLDRGILEALMGNATAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQ
2e7wA           --------------DEIDLRILKILQYNAYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPA-
2acjD           --------------EQRILKFLEELGEGKTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLW-
3boqA           --------------SLAKFDAAQLARNPDGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKAFSAGLTTFK
2a61A           ----------RDFGTPAQFDILQKIYFEGKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPA----
2d1hB           -SKKDEIRCCYKITDTDV-AVLLKVEIEKITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPK----
2efoA           --------------DEIDLRILKILQYNAYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPA-
2dbbB           --------------DRVDMQLVKILSENSLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDK
2acjC           ---------------HMEQRILKFLEELGTTAHDLSGKLGTPKKEINRVLYSLAKKGKL-QKEAGTPPLW
2efnA           --------------DEIDLRILKILQYNAYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAYINPA-
2dk5A           ----------KGSDNQEKYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNL-----------------
2eb7A           ---------------YLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVRDREDRRKILI
2co5A           ----------KYMRI-NYYIILKVLVINRLRSEILRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVL
2co5B           --------------NYYIILKVLVINGSLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVL
2d45A           --------------SSAEWEVNIIWKKYANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQY
2d45B           ----------KTYEISSAEWEVNIIWKKYNNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQY
2du9A           ---------YKQIASLIEDSIVDGTLSIDPSTNELAAFHRINPATARNGLTLLVEAGILY-KKRGIGFVS
2ek5A           ---------YKQIASLIEDSIVDGTLSIDPSTNELAAFHRINPATARNGLTLLVEAGILY-KKRGIGFVS


                         .         .         *         .         .         .         .:140
query           YFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKExxx
2cweA           YGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELL----
1bibA           EPIQLLNAKQILG--------------------------------------
3bp8A           ---------------------------------------------------
3bp8B           AWHYLSLRISRGEIFLALR--------------------------------
3cuoD           SIKNEAVNAI-----------------------------------------
1biaA           ---------------------------------------------------
2b0lA           IKVLN-NKFLIELENLKS---------------------------------
2cfxA           LGLPVSCIVEAT---------------------------------------
2d1hA           ---------------------------------------------------
3cuoC           SIKNEAVNAI-----------------------------------------
2efqA           LNLD-----------------------------------------------
3cuoA           SIKNEAVNAI-----------------------------------------
2dbbA           SDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLI------
2cg4A           LGYDVGCFIGIIL--------------------------------------
2e7wA           ---------------------------------------------------
2acjD           ---------------------------------------------------
3boqA           QASEAHNRILAELLRAVSDQDV-----------------------------
2a61A           ---------------------------------------------------
2d1hB           ---------------------------------------------------
2efoA           ---------------------------------------------------
2dbbB           LGYMYAIVLIKSKVP------------------------------------
2acjC           K--------------------------------------------------
2efnA           ---------------------------------------------------
2dk5A           ---------------------------------------------------
2eb7A           EITEKGLETFNKGIEIYKKNEVTGDLSEDEVILVLDKISKILKRIEEI---
2co5A           ---------------------------------------------------
2co5B           ---------------------------------------------------
2d45A           YSLVEESDIK-----------------------------------------
2d45B           YSLVEESDIK-----------------------------------------
2du9A           AQAPALIRERRDAAFAATYVA-PLIDESIHLGFTRARIHALLDQVAE----
2ek5A           AQAPALIRERRDAAFAATYVA-PLIDESIHLGFTRARIHALLDQVAE----