[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30541.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ehzA.bssp"
#ERROR : Can't open dsspfile "3eamA.bssp"
#ERROR : Can't open dsspfile "3ei0A.bssp"
#ERROR : Can't open dsspfile "2bg9E.bssp"
#ERROR : Can't open dsspfile "2bg9B.bssp"
#ERROR : Can't open dsspfile "2bg9C.bssp"
#ERROR : Can't open dsspfile "2bg9A.bssp"
#ERROR : Can't open dsspfile "2bypA.bssp"
#ERROR : Can't open dsspfile "3c84A.bssp"
#ERROR : Can't open dsspfile "3c84B.bssp"
#ERROR : Can't open dsspfile "3c84E.bssp"
#ERROR : Can't open dsspfile "3c79C.bssp"
#ERROR : Can't open dsspfile "2bypD.bssp"
#ERROR : Can't open dsspfile "2bypB.bssp"
#ERROR : Can't open dsspfile "2byrB.bssp"
#ERROR : Can't open dsspfile "2bynA.bssp"
#ERROR : Can't open dsspfile "2byqC.bssp"
#ERROR : Can't open dsspfile "2bysG.bssp"
#ERROR : Can't open dsspfile "2bysE.bssp"
#ERROR : Can't open dsspfile "2byrG.bssp"
#ERROR : Can't open dsspfile "2bysF.bssp"
#ERROR : Can't open dsspfile "2byrC.bssp"
#ERROR : Can't open dsspfile "2bypE.bssp"
#ERROR : Can't open dsspfile "2br8A.bssp"
#ERROR : Can't open dsspfile "2bysA.bssp"
#ERROR : Can't open dsspfile "2bj0A.bssp"
#ERROR : Can't open dsspfile "2byrH.bssp"
#ERROR : Can't open dsspfile "2bysC.bssp"
#ERROR : Can't open dsspfile "3c84D.bssp"
#ERROR : Can't open dsspfile "2bysD.bssp"
#ERROR : Can't open dsspfile "2bysB.bssp"
#ERROR : Can't open dsspfile "3c84C.bssp"
#ERROR : Can't open dsspfile "3c79E.bssp"
#ERROR : Can't open dsspfile "2bynC.bssp"
#ERROR : Can't open dsspfile "2bynD.bssp"

## Summary of PDB Search
:351
    3e-33  23%  3ehzA  [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]
    3e-33  23%  3eamA  [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 91 / COIL(x) 0]
    5e-33  23%  3ei0A  [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]
    3e-22  21%  2bg9E  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN[MASQUE :
    4e-22  19%  2bg9B  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN[MASQUE :
    3e-21  21%  2bg9C  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN[MASQUE :
    8e-16  18%  2bg9A  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN[MASQUE :
    5e-15  14%  2bypA  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    1e-14  13%  3c84A  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    1e-14  11%  3c84B  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    4e-14  12%  3c84E  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    5e-14  11%  3c79C  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    7e-14  13%  2bypD  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    7e-14  13%  2bypB  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    1e-13  15%  2byrB  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    2e-13  13%  2bynA  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    3e-13  12%  2byqC  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    3e-13  12%  2bysG  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    5e-13  12%  2bysE  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    8e-13  14%  2byrG  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-12  13%  2bysF  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    2e-12  11%  2byrC  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    4e-12  12%  2bypE  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    4e-12  13%  2br8A  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    7e-12  12%  2bysA  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    9e-12  14%  2bj0A  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-09  12%  2byrH  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    2e-09  12%  2bysC  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    4e-09  12%  3c84D  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    3e-08  12%  2bysD  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    3e-08  12%  2bysB  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-07  12%  3c84C  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    3e-07  12%  3c79E  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    7e-07  12%  2bynC  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
    2e-06  12%  2bynD  [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
3ehzA           ---------------------------PPPEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
3eamA           ---------------------------PPPEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
3ei0A           ---------------------------PPPEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
2bg9E           ------------------------------HVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLS
2bg9B           ------------------------------DKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQ
2bg9C           --------------------------------------------------DETLTTNVWMDHAWYDHRLT
2bg9A           --------------------------------------------------NQIVETNVRLRQQWIDVRLR
2bypA           -----------------KSDLFRYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c84A           -----------------KSDLFNRSPMYPDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c84B           ---------------------------TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c84E           ---------------------------TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c79C           ---------------------------TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bypD           -----------------------------DDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bypB           -----------------KSDLFNRSPMYPDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2byrB           -----------------KSDLFNRSPMYPGPPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bynA           -----------------KSDLFNRSPMYPDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2byqC           ----------------------------KDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysG           ------------------------------DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysE           ----------------NLMRLKSDLFNYPGPPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2byrG           ----------------LKSDLFNRSPMYPDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysF           -----------------KSDLFRYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2byrC           ---------------------------TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bypE           -----------------------------DDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2br8A           -----------------KSDLFNRSPMYPDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLM
2bysA           ----------------------------KDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bj0A           ------------------------------TPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYY-
2byrH           ------------------------------DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysC           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c84D           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysD           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bysB           ------------------------------DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c84C           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
3c79E           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bynC           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM
2bynD           -------------------------------PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLM


                         .         .         *         .         .         .         .:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
3ehzA           FDPVRSGVRVKTYEPE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
3eamA           FDPVRSGVRVKTYEPE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
3ei0A           FDPVRSGVRVKTYEPE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
2bg9E           WNTSEYEGIDLVR------IPSELLWLPDVVLENNVDGQFAYYANVLVYNDGSMYWLPPAIYRSTCPIAV
2bg9B           WDPAAYEGIKDLSIPSDDV------WQPDIVLMNNNDGSFTLHVNVLVQHTGAVSWHPSAIYRSSCTIKV
2bg9C           WNASEYSDISILRLRPELI------WIPDIVLQNNNDGQYAYFCNVLVRPNGYVTWLPPAIFRSSCPINV
2bg9A           WNPADYGPSDDVWLPDLVLYNNADGDFAIVHMTKLL-----------LDYTGKIMWTPPAIFKSYCEIIV
2bypA           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c84A           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c84B           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c84E           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c79C           WDPNEYGNITDFRTSAADI------WTPDITAYSSRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-T
2bypD           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDP-T
2bypB           WDPNEYGNI------TDFRTSAADIWTPDITAYSSRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2byrB           WDPNE-------YGNTDFRTSAADIWTPDITAYSSTRPVQVLSPQIVVTHDGSVMFIPAQRLSFMCDPTG
2bynA           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2byqC           WDPNEYGNITDFRTSAADI------WTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysG           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysE           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2byrG           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysF           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2byrC           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bypE           WDPNEYGNITDF------RTSAADIWTPDITAYSVQVLSPQIAV---VTHDGSVMFIPAQRLSFMCDPTG
2br8A           WDPNEYGNI------TDFRTSAADIWTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysA           WDPNEYGNITDFRTSAADI------WTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bj0A           ---SSLLSSSSLDQVSLPVSKM---WTPDLSFYNIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLIN
2byrH           WDPNEYGNITDFRTSAADI------WTPDITAYSSTRPVQVLSQIAVVTHDGSVMFIPAQRLSFMCDP-T
2bysC           WDPNEYGNITDFRTSAADI------WTPDITAYSSTRPVQVLSQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c84D           WDPNEYGNITDFRTSAADI------WTPDITAYSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysD           WDPNEYGNITDFRTSAADI------WTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
2bysB           WDPNEYGNITDFRTSAADI------WTPDITAYSSTRPVQVSPQIAVVTHDGSVMFIPAQRLSFMCDPTG
3c84C           WDPNEYGNITDFRTSAADI------WTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-T
3c79E           WDPNEYGNITDFRTSAADI------WTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-T
2bynC           WDPNEYGNITDFRTSAADI------WTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-T
2bynD           WDPNEYGNITDFRTSAADI------WTPDITAYSSTPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-T


                         +         .         .         .         .         *         .:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
3ehzA           RRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPANFALE-
3eamA           RRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPANFALE-
3ei0A           RRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPANFAL-E
2bg9E           TYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENG------EWTIRHRPAKKNY-NWQLTKD
2bg9B           MYFPFDWQNCTMVFKSYTYDTSEVILQHALDAMINQDAF-----------TENGQWSIEHKPSRKNWRSD
2bg9C           LYFPFDWQNCSLKFTALNYNANEISM----DLIIDPEAFTEN------GEWEIIHKPAKKNIYGDKFPNG
2bg9A           THFPFDQQNCTMKLGIWTYDGTKVSISPESDR-PDLSTF------MESGEWVM--KDYRGWKHWVYYTCC
2bypA           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSCCP
3c84A           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
3c84B           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
3c84E           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSCCP
3c79C           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bypD           GVDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bypB           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSYYASS------KYEILSATQTRQV-QHYSCCP
2byrB           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTD-QVDLSSYYAS------SKY--EILSATQTRQVQHYSCC
2bynA           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2byqC           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bysG           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bysE           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2byrG           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bysF           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2byrC           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bypE           -VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2br8A           -VDSEEGVTCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bysA           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTR-QVQHYSCCP
2bj0A           -VDTEPGATCRIKVGSWTHDNKQFALITGEEGVVNIAEY------FDSPKFDLLSATQSLNR--KKYSCC
2byrH           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bysC           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP
3c84D           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bysD           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
2bysB           -VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP
3c84C           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP
3c79E           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bynC           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP
2bynD           GVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP


                         .         .         .         +         .         .         .:280
query           PQRISMLEFSISLERKPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ehzA           DRLESKLDYQLRISRQ------------------------------------------------------
3eamA           DRLESKLDYQLRISRQ------------------------------------------------------
3ei0A           DRLESKLDYQLRISRQ------------------------------------------------------
2bg9E           DIDFQEIIFFLIIQRKP-----------------------------------------------------
2bg9B           DPSYEDVTFYLIIQRKP-----------------------------------------------------
2bg9C           TNY-QDVTFYLIIRRKP-----------------------------------------------------
2bg9A           PDPYLDITYHFIMQRIP-----------------------------------------------------
2bypA           EPYID-VNLVVKFRER------------------------------------------------------
3c84A           EPYID-VNLVVKFRER------------------------------------------------------
3c84B           EPYID-VNLVVKFRER------------------------------------------------------
3c84E           EPYID-VNLVVKFRER------------------------------------------------------
3c79C           EPYID-VNLVVKFRER------------------------------------------------------
2bypD           EPYID-VNLVVKFRER------------------------------------------------------
2bypB           EPYID-VNLVVKFRER------------------------------------------------------
2byrB           PEPYIDVNLVVKFRERR-----------------------------------------------------
2bynA           EPYID-VNLVVKFRER------------------------------------------------------
2byqC           EPYID-VNLVVKFRER------------------------------------------------------
2bysG           EPYID-VNLVVKFRER------------------------------------------------------
2bysE           EPYID-VNLVVKFRER------------------------------------------------------
2byrG           EPYID-VNLVVKFRER------------------------------------------------------
2bysF           EPYID-VNLVVKFRER------------------------------------------------------
2byrC           EPYID-VNLVVKFRER------------------------------------------------------
2bypE           EPYID-VNLVVKFRER------------------------------------------------------
2br8A           EPYID-VNLVVKFRER------------------------------------------------------
2bysA           EPYID-VNLVVKFRER------------------------------------------------------
2bj0A           ENMYDDIEITFAFRKK------------------------------------------------------
2byrH           EPYIDV-NLVVKFRER------------------------------------------------------
2bysC           EPYIDV-NLVVKFRER------------------------------------------------------
3c84D           EPYIDV-NLVVKFRER------------------------------------------------------
2bysD           EPYIDV-NLVVKFRER------------------------------------------------------
2bysB           EPYIDV-NLVVKFRER------------------------------------------------------
3c84C           EPYIDV-NLVVKFRER------------------------------------------------------
3c79E           EPYIDV-NLVVKFRER------------------------------------------------------
2bynC           EPYIDV-NLVVKFRER------------------------------------------------------
2bynD           EPYIDV-NLVVKFRER------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ehzA           ----------------------------------------------------------------------
3eamA           ----------------------------------------------------------------------
3ei0A           ----------------------------------------------------------------------
2bg9E           ----------------------------------------------------------------------
2bg9B           ----------------------------------------------------------------------
2bg9C           ----------------------------------------------------------------------
2bg9A           ----------------------------------------------------------------------
2bypA           ----------------------------------------------------------------------
3c84A           ----------------------------------------------------------------------
3c84B           ----------------------------------------------------------------------
3c84E           ----------------------------------------------------------------------
3c79C           ----------------------------------------------------------------------
2bypD           ----------------------------------------------------------------------
2bypB           ----------------------------------------------------------------------
2byrB           ----------------------------------------------------------------------
2bynA           ----------------------------------------------------------------------
2byqC           ----------------------------------------------------------------------
2bysG           ----------------------------------------------------------------------
2bysE           ----------------------------------------------------------------------
2byrG           ----------------------------------------------------------------------
2bysF           ----------------------------------------------------------------------
2byrC           ----------------------------------------------------------------------
2bypE           ----------------------------------------------------------------------
2br8A           ----------------------------------------------------------------------
2bysA           ----------------------------------------------------------------------
2bj0A           ----------------------------------------------------------------------
2byrH           ----------------------------------------------------------------------
2bysC           ----------------------------------------------------------------------
3c84D           ----------------------------------------------------------------------
2bysD           ----------------------------------------------------------------------
2bysB           ----------------------------------------------------------------------
3c84C           ----------------------------------------------------------------------
3c79E           ----------------------------------------------------------------------
2bynC           ----------------------------------------------------------------------
2bynD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
3ehzA           -
3eamA           -
3ei0A           -
2bg9E           -
2bg9B           -
2bg9C           -
2bg9A           -
2bypA           -
3c84A           -
3c84B           -
3c84E           -
3c79C           -
2bypD           -
2bypB           -
2byrB           -
2bynA           -
2byqC           -
2bysG           -
2bysE           -
2byrG           -
2bysF           -
2byrC           -
2bypE           -
2br8A           -
2bysA           -
2bj0A           -
2byrH           -
2bysC           -
3c84D           -
2bysD           -
2bysB           -
3c84C           -
3c79E           -
2bynC           -
2bynD           -