[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30570.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d0fA.bssp"
#ERROR : Can't open dsspfile "1bvzA.bssp"
#ERROR : Can't open dsspfile "3edeA.bssp"
#ERROR : Can't open dsspfile "2bhuA.bssp"
#ERROR : Can't open dsspfile "3edfA.bssp"
#ERROR : Can't open dsspfile "3ecqB.bssp"
#ERROR : Can't open dsspfile "1ehaA.bssp"
#ERROR : Can't open dsspfile "2bhyA.bssp"
#ERROR : Can't open dsspfile "2bhzA.bssp"
#ERROR : Can't open dsspfile "2e8yA.bssp"
#ERROR : Can't open dsspfile "1eh9A.bssp"
#ERROR : Can't open dsspfile "1cgtA.bssp"
#ERROR : Can't open dsspfile "1cguA.bssp"
#ERROR : Can't open dsspfile "6cgtA.bssp"
#ERROR : Can't open dsspfile "1cgxA.bssp"
#ERROR : Can't open dsspfile "3ecqA.bssp"
#ERROR : Can't open dsspfile "3eddA.bssp"
#ERROR : Can't open dsspfile "1bvnP.bssp"
#ERROR : Can't open dsspfile "1dhkA.bssp"
#ERROR : Can't open dsspfile "2dieA.bssp"
#ERROR : Can't open dsspfile "3cgtA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "3czeA.bssp"
#ERROR : Can't open dsspfile "3bh4A.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "3czkA.bssp"
#ERROR : Can't open dsspfile "3czgA.bssp"
#ERROR : Can't open dsspfile "1e3xA.bssp"
#ERROR : Can't open dsspfile "1cgvA.bssp"
#ERROR : Can't open dsspfile "2d73A.bssp"
#ERROR : Can't open dsspfile "1cgwA.bssp"
#ERROR : Can't open dsspfile "1b0iA.bssp"
#ERROR : Can't open dsspfile "3czlA.bssp"
#ERROR : Can't open dsspfile "1ea9C.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "1c7tA.bssp"
#ERROR : Can't open dsspfile "1bliA.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "1dtuA.bssp"
#ERROR : Can't open dsspfile "1cxlA.bssp"
#ERROR : Can't open dsspfile "1cgyA.bssp"
#ERROR : Can't open dsspfile "1cdgA.bssp"
#ERROR : Can't open dsspfile "1bf2A.bssp"
#ERROR : Can't open dsspfile "1d3cA.bssp"
#ERROR : Can't open dsspfile "3bakA.bssp"
#ERROR : Can't open dsspfile "2cpuA.bssp"
#ERROR : Can't open dsspfile "1aqmA.bssp"
#ERROR : Can't open dsspfile "1avaA.bssp"
#ERROR : Can't open dsspfile "2aaaA.bssp"
#ERROR : Can't open dsspfile "1d7fA.bssp"
#ERROR : Can't open dsspfile "3dhuA.bssp"
#ERROR : Can't open dsspfile "2c7fD.bssp"
#ERROR : Can't open dsspfile "3dhpA.bssp"
#ERROR : Can't open dsspfile "2dh3B.bssp"
#ERROR : Can't open dsspfile "3dhuB.bssp"
#ERROR : Can't open dsspfile "1c7sA.bssp"
#ERROR : Can't open dsspfile "2c8nD.bssp"
#ERROR : Can't open dsspfile "3blpX.bssp"
#ERROR : Can't open dsspfile "2c7fF.bssp"
#ERROR : Can't open dsspfile "2dh2A.bssp"
#ERROR : Can't open dsspfile "3blkA.bssp"
#ERROR : Can't open dsspfile "2c8nF.bssp"
#ERROR : Can't open dsspfile "2c8nE.bssp"
#ERROR : Can't open dsspfile "2dh3A.bssp"
#ERROR : Can't open dsspfile "1amg-.bssp"
#ERROR : Can't open dsspfile "2c8nB.bssp"
#ERROR : Can't open dsspfile "2c8nA.bssp"
#ERROR : Can't open dsspfile "2c7fB.bssp"
#ERROR : Can't open dsspfile "3clwA.bssp"
#ERROR : Can't open dsspfile "3cnyA.bssp"
#ERROR : Can't open dsspfile "2choA.bssp"
#ERROR : Can't open dsspfile "2c7fE.bssp"
#ERROR : Can't open dsspfile "2choB.bssp"
#ERROR : Can't open dsspfile "3bsgA.bssp"
#ERROR : Can't open dsspfile "2c7fC.bssp"
#ERROR : Can't open dsspfile "3bshA.bssp"
#ERROR : Can't open dsspfile "3dc0A.bssp"
#ERROR : Can't open dsspfile "3cc1B.bssp"
#ERROR : Can't open dsspfile "1a0dA.bssp"
#ERROR : Can't open dsspfile "3clwC.bssp"
#ERROR : Can't open dsspfile "2bfgA.bssp"
#ERROR : Can't open dsspfile "3cttA.bssp"
#ERROR : Can't open dsspfile "2bs9A.bssp"
#ERROR : Can't open dsspfile "1bagA.bssp"
#ERROR : Can't open dsspfile "1bplB.bssp"
#ERROR : Can't open dsspfile "2c7fA.bssp"
#ERROR : Can't open dsspfile "3b40A.bssp"
#ERROR : Can't open dsspfile "3cc1A.bssp"
#ERROR : Can't open dsspfile "2droA.bssp"
#ERROR : Can't open dsspfile "1cbyA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "1b5tB.bssp"
#ERROR : Can't open dsspfile "3bobA.bssp"
#ERROR : Can't open dsspfile "2aamC.bssp"
#ERROR : Can't open dsspfile "2aamA.bssp"
#ERROR : Can't open dsspfile "3a5vA.bssp"
#ERROR : Can't open dsspfile "1cz1A.bssp"
#ERROR : Can't open dsspfile "2c0hA.bssp"
#ERROR : Can't open dsspfile "1bxcA.bssp"
#ERROR : Can't open dsspfile "1eceA.bssp"
#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "2aamB.bssp"
#ERROR : Can't open dsspfile "1chkA.bssp"
#ERROR : Can't open dsspfile "2agaA.bssp"
#ERROR : Can't open dsspfile "3civA.bssp"
#ERROR : Can't open dsspfile "1bplA.bssp"
#ERROR : Can't open dsspfile "2cwtA.bssp"
#ERROR : Can't open dsspfile "2cleA.bssp"
#ERROR : Can't open dsspfile "2ckrA.bssp"
#ERROR : Can't open dsspfile "1a5sA.bssp"
#ERROR : Can't open dsspfile "3coyA.bssp"
#ERROR : Can't open dsspfile "2e3zB.bssp"
#ERROR : Can't open dsspfile "3bc9A.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1cbgA.bssp"
#ERROR : Can't open dsspfile "1ac0A.bssp"
#ERROR : Can't open dsspfile "1bqcA.bssp"
#ERROR : Can't open dsspfile "1cqyA.bssp"
#ERROR : Can't open dsspfile "1a5bA.bssp"
#ERROR : Can't open dsspfile "2e3zA.bssp"
#ERROR : Can't open dsspfile "3cozB.bssp"
#ERROR : Can't open dsspfile "2cliA.bssp"
#ERROR : Can't open dsspfile "3c0uA.bssp"
#ERROR : Can't open dsspfile "2eiyB.bssp"
#ERROR : Can't open dsspfile "3a21A.bssp"
#ERROR : Can't open dsspfile "2c3wA.bssp"
#ERROR : Can't open dsspfile "1e4mM.bssp"
#ERROR : Can't open dsspfile "2dkdB.bssp"
#ERROR : Can't open dsspfile "3cepA.bssp"
#ERROR : Can't open dsspfile "1b31A.bssp"
#ERROR : Can't open dsspfile "2a6tA.bssp"
#ERROR : Can't open dsspfile "2diwA.bssp"
#ERROR : Can't open dsspfile "2cksA.bssp"
#ERROR : Can't open dsspfile "1de5A.bssp"
#ERROR : Can't open dsspfile "1bksA.bssp"
#ERROR : Can't open dsspfile "2ej0F.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "2c3wD.bssp"
#ERROR : Can't open dsspfile "3a21B.bssp"
#ERROR : Can't open dsspfile "2cncA.bssp"

## Summary of PDB Search
:640
    1e-72  11%  2d0fA  [x.x.x] ALPHA-AMYLASE I
    9e-69  13%  1bvzA  [b.1.18 - c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE II)
    4e-66  16%  3edeA  [x.x.x] CYCLOMALTODEXTRINASE
    2e-64  20%  2bhuA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    3e-63  15%  3edfA  [x.x.x] CYCLOMALTODEXTRINASE
    8e-60   8%  3ecqB  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    3e-59  19%  1ehaA  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    1e-58  18%  2bhyA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    9e-57  18%  2bhzA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    3e-53  17%  2e8yA  [x.x.x] AMYX PROTEIN
    5e-52  19%  1eh9A  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    1e-50  12%  1cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    1e-50  11%  1cguA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    4e-50  11%  6cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    2e-49  15%  1cgxA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    1e-48   9%  3ecqA  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-48  13%  3eddA  [x.x.x] CYCLOMALTODEXTRINASE
    2e-48  13%  1bvnP  [c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE)
    2e-48  14%  1dhkA  [c.1.8 - b.71.1] PORCINE PANCREATIC ALPHA-AMYLASE
    1e-47  12%  2dieA  [x.x.x] AMYLASE
    3e-47  11%  3cgtA  [c.1.8 - b.71.1 - b.1.18 - b.3.1 (8cgtA)] CYCLODEXTRIN
    3e-47  10%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-47  12%  3czeA  [x.x.x] SUCROSE HYDROLASE
    1e-46  10%  3bh4A  [x.x.x] ALPHA-AMYLASE
    3e-46  12%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    5e-46  15%  3czkA  [x.x.x] SUCROSE HYDROLASE
    1e-45  10%  3czgA  [x.x.x] SUCROSE HYDROLASE
    6e-44  10%  1e3xA  [c.1.8 - b.71.1] ALPHA-AMYLASE
    9e-44  15%  1cgvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    1e-43  10%  2d73A  [x.x.x] ALPHA-GLUCOSIDASE SUSB
    8e-43  15%  1cgwA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    9e-43  13%  1b0iA  [c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE)
    6e-42  13%  3czlA  [x.x.x] SUCROSE HYDROLASE
    1e-41  15%  1ea9C  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    1e-41  11%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    4e-41   6%  1c7tA  [b.2.2 - d.92.2 - c.1.8 - b.1.18] BETA-N-ACETYLHEXOSAMINIDASE
    4e-41   9%  1bliA  [x.x.x] ALPHA-AMYLASE
    2e-40  13%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    3e-40  15%  1dtuA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    6e-40  16%  1cxlA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
    8e-40  16%  1cgyA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    1e-39  15%  1cdgA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    1e-39  16%  1bf2A  [x.x.x] ISOAMYLASE
    2e-39  14%  1d3cA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-38  12%  3bakA  [x.x.x] PANCREATIC ALPHA-AMYLASE
    4e-38  12%  2cpuA  [c.1.8 - b.71.1] ALPHA-AMYLASE
    5e-38  13%  1aqmA  [c.1.8 - b.71.1 (1g94A)] ALPHA-AMYLASE
    1e-37  14%  1avaA  [c.1.8 - b.71.1] BARLEY ALPHA-AMYLASE 2(CV MENUET)
    8e-36  14%  2aaaA  [x.x.x] ALPHA-AMYLASE
    2e-35  15%  1d7fA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    4e-35  16%  3dhuA  [x.x.x] ALPHA-AMYLASE
    5e-35   8%  2c7fD  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    6e-35  12%  3dhpA  [x.x.x] ALPHA-AMYLASE 1
    1e-34  17%  2dh3B  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    3e-34  17%  3dhuB  [x.x.x] ALPHA-AMYLASE
    3e-34   7%  1c7sA  [b.2.2 - d.92.2 - c.1.8 - b.1.18] BETA-N-ACETYLHEXOSAMINIDASE
    5e-34   9%  2c8nD  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    2e-33  13%  3blpX  [x.x.x] ALPHA-AMYLASE 1
    2e-33   8%  2c7fF  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    4e-33  17%  2dh2A  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    5e-33  13%  3blkA  [x.x.x] ALPHA-AMYLASE 1
    9e-33   9%  2c8nF  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    2e-32   9%  2c8nE  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    2e-32  18%  2dh3A  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    9e-32  11%  1amg-  [x.x.x] 1,4-ALPHA-D-GLUCAN MALTOTETRAHYDROLASE (E.C.3.2.1.60)
    1e-31  10%  2c8nB  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    9e-31   9%  2c8nA  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    1e-30   9%  2c7fB  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    4e-30   8%  3clwA  [x.x.x] CONSERVED EXPORTED PROTEIN
    5e-30  10%  3cnyA  [x.x.x] INOSITOL CATABOLISM PROTEIN IOLE
    7e-30   8%  2choA  [x.x.x] GLUCOSAMINIDASE
    1e-29  10%  2c7fE  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    1e-29   5%  2choB  [x.x.x] GLUCOSAMINIDASE
    3e-29  18%  3bsgA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    8e-29   6%  2c7fC  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    1e-28  18%  3bshA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    7e-28  14%  3dc0A  [x.x.x] ALPHA-AMYLASE
    1e-27   9%  3cc1B  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-27  10%  1a0dA  [c.1.15] XYLOSE ISOMERASE
    1e-27   8%  3clwC  [x.x.x] CONSERVED EXPORTED PROTEIN
    5e-27   6%  2bfgA  [x.x.x] BETA-XYLOSIDASE
    8e-27   9%  3cttA  [x.x.x] MALTASE-GLUCOAMYLASE
    1e-26   6%  2bs9A  [x.x.x] BETA-XYLOSIDASE
    1e-26  14%  1bagA  [x.x.x] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    1e-25  11%  1bplB  [c.1.8 - b.71.1] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    2e-25   8%  2c7fA  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    4e-25   9%  3b40A  [x.x.x] PROBABLE DIPEPTIDASE
    4e-25   9%  3cc1A  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-24  12%  2droA  [x.x.x] XYLANASE Y
    2e-24   9%  1cbyA  [x.x.x] DELTA-ENDOTOXIN CYTB
    4e-24   7%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-23   9%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-22  10%  1b5tB  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    2e-22  10%  3bobA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    6e-22   9%  2aamC  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    8e-22   8%  2aamA  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    8e-22  12%  3a5vA  [x.x.x] ALPHA-GALACTOSIDASE
    1e-21  10%  1cz1A  [c.1.8] PROTEIN (EXO-B-(1,3)-GLUCANASE)
    3e-21   8%  2c0hA  [x.x.x] MANNAN ENDO-1,4-BETA-MANNOSIDASE
    1e-20   6%  1bxcA  [c.1.15] XYLOSE ISOMERASE
    3e-20   8%  1eceA  [c.1.8] ENDOCELLULASE E1
    4e-20  12%  1b5tA  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    1e-19   9%  2aamB  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    1e-19   9%  1chkA  [d.2.1] CHITOSANASE
    2e-19   8%  2agaA  [x.x.x] MACHADO-JOSEPH DISEASE PROTEIN 1
    3e-19   8%  3civA  [x.x.x] ENDO-BETA-1,4-MANNANASE
    7e-19  18%  1bplA  [c.1.8] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    9e-19  10%  2cwtA  [x.x.x] PHENYLETHYLAMINE OXIDASE
    2e-18   6%  2cleA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-18   8%  2ckrA  [x.x.x] ENDOGLUCANASE E-5
    8e-18   4%  1a5sA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    8e-17   6%  3coyA  [x.x.x] PANTOTHENATE SYNTHETASE
    9e-17  11%  2e3zB  [x.x.x] BETA-GLUCOSIDASE
    9e-17  19%  3bc9A  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    2e-16   8%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    8e-16   9%  1cbgA  [x.x.x] CYANOGENIC BETA-GLUCOSIDASE
    3e-15  20%  1ac0A  [x.x.x] GLUCOAMYLASE
    5e-15  10%  1bqcA  [c.1.8] PROTEIN (BETA-MANNANASE)
    6e-15  11%  1cqyA  [b.3.1] BETA-AMYLASE
    3e-14   7%  1a5bA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    3e-14  10%  2e3zA  [x.x.x] BETA-GLUCOSIDASE
    4e-14  10%  3cozB  [x.x.x] PANTOTHENATE SYNTHETASE
    2e-13   7%  2cliA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-13  11%  3c0uA  [x.x.x] UNCHARACTERIZED PROTEIN YAEQ
    6e-13  17%  2eiyB  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    8e-13   8%  3a21A  [x.x.x] PUTATIVE SECRETED ALPHA-GALACTOSIDASE
    1e-12  12%  2c3wA  [x.x.x] ALPHA-AMYLASE G-6
    2e-12   8%  1e4mM  [c.1.8] MYROSINASE
    2e-11   5%  2dkdB  [x.x.x] PHOSPHOACETYLGLUCOSAMINE MUTASE
    2e-10   9%  3cepA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-09   7%  1b31A  [c.1.8] PROTEIN (XYLANASE)
    8e-09   8%  2a6tA  [x.x.x] SPAC19A8.12
    1e-08   8%  2diwA  [x.x.x] PUTATIVE RNA-BINDING PROTEIN 16
    1e-07  10%  2cksA  [x.x.x] ENDOGLUCANASE E-5
    3e-07   6%  1de5A  [c.1.15] L-RHAMNOSE ISOMERASE
    2e-06   5%  1bksA  [c.1.2] TRYPTOPHAN SYNTHASE
    6e-06  17%  2ej0F  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    8e-06   4%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-05  15%  2c3wD  [x.x.x] ALPHA-AMYLASE G-6
    3e-05   7%  3a21B  [x.x.x] PUTATIVE SECRETED ALPHA-GALACTOSIDASE
    4e-05   8%  2cncA  [x.x.x] ENDOXYLANASE
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
2d0fA           -----------------DNNVEWNGDQGPLFDNAPEPTSTQ----SVTLKLRTFKGDITSAYWDTADNAF
1bvzA           ---------------------LLEAIFHEAKGSYAYPISET----QLRVRLRAKKGDVVRCYADRYASPE
3edeA           -----------TAIEHMEPPFWWAGMQHKGLQLMVHG----RDIGRMEAALDYPGVRLVSPTRVPNANYL
2bhuA           -------------------------TQHDPRTRLGATPL--PGGAGTRFRLWTSTARTVAVRVNGTEHVM
3edfA           -----------TAIEHMEPPFWWAGMQHKGLQLMVHG----RDIGRMEAALDYPGVRLVSPTRVPNANYL
3ecqB           --------------------------------------------AKGYYGFVSTDKLAAGVWSNSQNSYG
1ehaA           --------------------------------------------NEVIFTLWAPYQKSVKLKVLEKGLYE
2bhyA           -------------------------TQHDPRTRLGATPL--PGGAGTRFRLWTSTARTVAVRVNGTEHVT
2bhzA           -------------------------TQHDPRTRLGATPL--PGGAGTRFRLWTSTARTVAVRVNGTEHVT
2e8yA           -----------HPVTFGKIHCVRASSGHKTDLQIGAVIRTAAFDDHTVFKVWAPAATSAAVKLSHPNKSG
1eh9A           --------------------------------------------NEVIFTLWAPYQKSVKLKVLEKGLYE
1cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3ecqA           -LGNALVSVSSDQTGAKFDGATSNNTHVSGDDHIDVTNPKDLAKGYYGFVSTDKLAAGVWSNSQNSYGGG
3eddA           -----------TAIEHMEPPFWWAGMQHKGLQLMVHG----RDIGRMEAALDYPGVRLVSTTRVPNANYL
1bvnP           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
2dieA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
3czeA           ----------------------------------------------------------------------
3bh4A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3czkA           ----------------------------------------------------------------------
3czgA           ----------------------------------------------------------------------
1e3xA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
2d73A           ------------VIKEEHSQFGMNGDHIAFWIPYDTQEYDYTISRLSEIRGLMKEAITPNSSQTPFSQTG
1cgwA           ----------------------------------------------------------------------
1b0iA           ----------------------------------------------------------------------
3czlA           ----------------------------------------------------------------------
1ea9C           ---------------------FLEAVYHRPRKNFSYAYN--GTTVHLRIRTKKDDMTAVYALAGDKYMWD
1a47A           ----------------------------------------------------------------------
1c7tA           ---------------HAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKG
1bliA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1bf2A           ---------------------------------LGASYDAQQA--NITFRVYSSQATRIVLYAGYGVQES
1d3cA           ----------------------------------------------------------------------
3bakA           ----------------------------------------------------------------------
2cpuA           ----------------------------------------------------------------------
1aqmA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
3dhpA           ----------------------------------------------------------------------
2dh3B           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1c7sA           --------------VHAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKG
2c8nD           ----------------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
2c7fF           ----------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
2c8nF           ----------------------------------------------------------------------
2c8nE           ----------------------------------------------------------------------
2dh3A           ----------------------------------------------------------------------
1amg-           ----------------------------------------------------------------------
2c8nB           ----------------------------------------------------------------------
2c8nA           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
3clwA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
2choA           --------------------------------------------AVYQLNGGEEANPHAVKVLKELLGM-
2c7fE           ----------------------------------------------------------------------
2choB           --------------------------------------------AVYQLNGGEEANPHAVKVLKELLGM-
3bsgA           ----------------------------------------------------------------------
2c7fC           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
1a0dA           -----------------EKVGDKTMEEHLRFSVAYWHTFTGDGSDPFGAGNMRPWNKYSGMDLAKARVE-
3clwC           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
3cttA           --------------PSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDA--
2bs9A           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2c7fA           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1cbyA           ----------------------------------------------------------------------
1bglA           ----------------RDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQG
3czjA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2cwtA           -----------------------------------------EVVEQLLATDERWLK-ALA-----ARNLD
2cleA           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
2e3zB           ----------------------------------------------------------------------
3bc9A           ----------------------------------------------------------------------
3dymA           ----------------RDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQG
1cbgA           ----------------------------------------------------------------------
1ac0A           ------------------------------------------TAVAVTFDLTATTTYNIYLVGSISQLGD
1bqcA           ----------------------------------------------------------------------
1cqyA           ----------------------------------------------QTIVVKNVPTDTVYITGNRASWDT
1a5bA           ----------------------------------------------------------------------
2e3zA           ----------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
2c3wA           -----------------------------------------DATDITIYYKTGWTHPHIHYSLNQGAWTT
1e4mM           ----------------------------------------------------------------------
2dkdB           -------------------------------------------------------DKLDYVTFTVGIIAS
3cepA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           ----------------------------------------------------------------------
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           ----------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           ---------------------------------------------------TGWTHPHIHYSLNQGAWTT
3a21B           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
2d0fA           HWVPMVWDSNTFDYWKGTIPASPSIKYYRFQINDGT-STAWYNGNGPSSTEPNADDFYIIPNFKTPDWLK
1bvzA           EELGKAGSDERFDYFEALLECSTKRVKYVFLLTGPQ-GEAVYFGETGFSAERSKAGVFQYAYIHRSEVFT
3edeA           FVDLEIGPEAQPGSFDIVFKGDGRSERYRYRLLARE--------QGSAQRQGFGPGDAIYQIMPDRFANG
2bhuA           -------TSLGGGIYELELP-VGPGARYLF------VLDGVPTPDPYARFLPDGVHGEAEVVDFGTFDWT
3edfA           FVDLEIGPEAQPGSFDIVFKGDGRSERYRYRLLARE--------QGSAQRQGFGPGDAIYQIMPDRFANG
3ecqB           GGSNDWTRLTKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITEDANADK-----KVDWQ
1ehaA           MERD------EKGYFTITLNNVKVRDRYKYVLDDAS-----EIPDPASRYQPEGVHGPSQIIQES-KEFN
2bhyA           SLGG--------GIYELELP-VGPGARYLFVLD------GVPTPDPYARFLPDGVHGEAEVVDFGTFDWT
2bhzA           SL--------GGGIYELELP-VGPGARYLFVLDGV------PTPDPYARFLPDGVHGEAEVVDFGTFDWT
2e8yA           RTFQMTR--LEKGVYAVTVTGDLHGYEYLFCICNNSEW--METVDQYAKAVTVNGEKGVVLRPDQ-MKWT
1eh9A           MERD------EKGYFTITLNNVKVRDRYKYVLDDAS-----EIPDPASRYQPEGVHGPSQIIQES-KEFN
1cgtA           --------------------------------------------DPDTAVTNKQSFSTDVI-----YQVF
1cguA           --------------------------------------------DPDTAVTNKQSFSTDVIYQVFTDRFL
6cgtA           --------------------------------------------DPDTAVTNKQSFSTDVI-----YQVF
1cgxA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
3ecqA           SNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITEDANAD-----KKVDWQ
3eddA           FVDLEIGPEAQPGSFDIVFKGDGRSERYRYRLLARE--------QGSAQRQGFGPGDAIYQIMPDRFANG
1bvnP           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
2dieA           ----------------------------------------------------------------------
3cgtA           --------------------------------------------DPDTAVTNKQSFSTDVI-----YQVF
3bmvA           ---------------------------------------------------------ASDTAVSNVVNYS
3czeA           ------------------------PPALRAAFAGPLAEVLLSRYDQHASRLLDALHALYGQRA--DYASW
3bh4A           ----------------------------------------------------------------------
1cygA           --------------------------------------------------------------------FT
3czkA           -------PALRAAFAGPLDPQHAEVLLHASRLLDALHALYGQRADYASWLAQWLGEVGDIARQRPQALQT
3czgA           ------------AFAGPLDPQHAEVDQHASRLLDALHALYGQRADYASWLAQWLGEVGDIA----RQRPQ
1e3xA           ----------------------------------------------------------------------
1cgvA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
2d73A           VQT-ALMMKTDDGLYINLHEAALVDYSCMHLNLDDK---------NMVFESWLTPDAKGDKGYMQTPCNT
1cgwA           ---------------------------------------------PDTSVSNKQNFSTDVIYQIFTDRFS
1b0iA           ----------------------------------------------------------------------
3czlA           ------------AFAGPLDPQHAEVDQHASRLLDALHALYGQRADYASWLAQWLGEVGDIARQRPQALQT
1ea9C           HTMEYVPTDELFDYWECEVTPPYRRVKYGFLLQQGH-EKRWMTEYDFLTEPPANPDRLFEYVFQPPAWVK
1a47A           ---------------------------------------------------------ASDTAVSNVVNYS
1c7tA           AMAVSGAYELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDAPRFPYRGIFLDVARNF
1bliA           ----------------------------------------------------------------------
4cgtA           --------------------------------------------DPDTAVTNKQSFSTDVI-----YQVF
1dtuA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
1cxlA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
1cgyA           ---------------------------------------------PDTSVSNKQNFSTDVIYQIFTDRFS
1cdgA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
1bf2A           ATYTLSPAGSGVWAVTVPVSSIKAGPNWPYASNWGKGSQAKLLLDPYAQEVSQDPLNPSNQNGNVFASGA
1d3cA           ---------------------------------------------PDTSVSNKQNFSTDVI-----YQIF
3bakA           ----------------------------------------------------------------------
2cpuA           ----------------------------------------------------------------------
1aqmA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1d7fA           ---------------------------------------------PDTSVSNKQNFSTDVIYQIFTDRFS
3dhuA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
3dhpA           ----------------------------------------------------------------------
2dh3B           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1c7sA           AMAVSGAYELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDAPRFPYRGIFLDVARNF
2c8nD           ----------------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
2c7fF           ----------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
2c8nF           -------------------------------------------------------------------TVD
2c8nE           ----------------------------------------------------------------------
2dh3A           ----------------------------------------------------------------------
1amg-           ------------------------------------------------------------------AGKS
2c8nB           ----------------------------------------------------------------------
2c8nA           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
3clwA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
2choA           --LISIGEKGDKSVRKYSRQIPDHKEGYYLSVNEKEIVL---AGNDERGTYYALQTFAQLLKDGKLPEV-
2c7fE           ----------------------------------------------------------------------
2choB           ------------LISIGEKGDKSVRKYSRQIPDHK-----------EGYYLSVNEKEIVLAGNDERGTYY
3bsgA           ----------------------------------------------------------------------
2c7fC           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
1a0dA           ---AAFEFFEKLNIFCFHDVDIAPEGETLKETYKNLDIIVLLWNTANLFTHPRFVHGAATSCNADVFAYA
3clwC           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
3cttA           -----------SGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPE--------------
2bs9A           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2c7fA           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2droA           ------------------------------------------------------------------FAWS
1cbyA           ----------------------------------------------------------------------
1bglA           ETQVASGT--APFGGEIIDERGGYADRVTLRLNVENPKLW-SAEIPNLYRAVVELHTADGTLIE--AEAC
3czjA           ----------------------------------------------------------------------
1b5tB           --------------FEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDIKDRTGLEAAPHLT
3bobA           -----------------------------------------------AEALQGRGWDAEIVT----DASM
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cz1A           --------------------------------------------------------------------PY
2c0hA           ------------------------------------------------------------------LSVS
1bxcA           ----------------------------------------------------------------------
1eceA           ------------------------------------------------------------------WHTS
1b5tA           --------------FEFFPPRTSEMEQTLWSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGL
2aamB           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2cwtA           VSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDDVVSKEVTRVIDTGVFPEHGNYTDP
2cleA           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
2e3zB           ----------------------------------------------------------------------
3bc9A           ----------------------------------------------------------------------
3dymA           ETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFR
1cbgA           ----------------------------------------------FKPLPISFDDFSDLNRSFGTASSA
1ac0A           WETSADKYTSSDPLWYVTVTPAGESFEYKFIRIESDDS-VEWESDPNREYTVPQACGTSTAT--VTDTW-
1bqcA           ----------------------------------------------------------------------
1cqyA           KQYPIQLYYDSHNDWRGNVVPAERNIEFKAFIKSKDGTVKSWQTIQQSWN--PVPLKTTSHT----SSW-
1a5bA           ----------------------------------------------------------------------
2e3zA           ----------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
2c3wA           LPGVPLTKSEYEGYVKVTIE-AEEGSQLRAAFNNGSGQ--------------------------------
1e4mM           ----------------------------------------------------------------------
2dkdB           LRS-KYLQGKTVGVMITASHNPPEDNGVKVVDPLGSMLESSWEKYATDLANASPSPNSLVEVIKNLVSDL
3cepA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           ----------------------------------------------------------------------
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           ----------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           LPGVPLTKSEYEGYVKVTIE-AEEGSQLRAAFNNNQGRDYD-----------------------------
3a21B           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
2d0fA           NGVMYQIFPDRFYNGDSSNDVQTGSYTYNGTPTEGGDLAGIDQKLGYIKKTLGANILYLNPIFKAPTN--
1bvzA           TPEWAKEAANGDPSNDPPGTEQWAKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSH--
3edeA           DPSN-------------DNVAGMREQADRRHGGGRHGGDITIDHLD-YIAGLGFTQLWPTPLVENDAAAY
2bhuA           DADWHGIKLA------DCVFYEVHVGTFT----PEGTYRAAAEKLP-YLKELGVTAIQVMPLAAFDGQRG
3edfA           DPSN-------------DNVAGMREQADRRHGGGRHGGDIRGIDHLDYIAGLGFTQLWPTPLVENDAAAY
3ecqB           DGAIAYRSNNPQGWKKVKDITAYRIANFGSQAQ--NPFLTLDGIKKINLHTDGLGQGVLLKGYGSE---G
1ehaA           NETFLK--------KEDLIIYEIHVGTFT----PEGTFEGVIRKLD-YLKDLGITAIEIMPIAQFPGKRD
2bhyA           DADW------HGIKLADCVFYEVHVGTFT----PEGTYRAAAEKLP-YLKELGVTAIQVPLAAFDGQRG-
2bhzA           DADW------HGIKLADCVFYEVHVGTFT----PEGTYRAAAEKLP-YLKELGVTAIQVPLAAFDGQRG-
2e8yA           APLKPFSHPV------DAVIYETHLRDFSIHENTDTQTANGSSSGLAYVKELGVTHVELLPVNDFAGVYN
1eh9A           NETFLKKE--------DLIIYEIHVGTFT----PEGTFEGVIRKLD-YLKDLGITAIEIMPIAQFPGKRD
1cgtA           TDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDN----YFSDLGVTALWISQPVENINTAY
1cguA           DGNPSNNPTGAAYDATCSNLKLYCGGDWQ-----GLINKINDN----YFSDLGVTALWISQPVENIFAAY
6cgtA           TDRFLDGNPSNNPTGAAYDATCSNLKLYC-----GGDWQGLINKINNYFSDLGVTALWISQPVENINTAY
1cgxA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSII
3ecqA           DGAIAYRSINPQGWKKVKDITAYRIANFGSQAQN--PFLTLDGIKKINLHTDGLGQGVLLKGYGSEG---
3eddA           DPSN----------DNVAGMREQADRRHGGGRHGG-DIRGTIDHLD-YIAGLGFTQLWPTPLVENDAAAY
1bvnP           ----------------SGRTDIVHLFEWRWVDI-------ALECER-YLGPKGFGGVQVSPPNENVVVPW
1dhkA           ----------------SGRTSIVHLFEWRWVDI-------ALECER-YLGPKGFGGVQVSPPNENVVVPW
2dieA           --------------------MQYFEWHLPNDGN---HWNRLRDDAA-NLKSKGITAVWIPPAWKGTSQND
3cgtA           TDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDN----YFSDLGVTALWISQPVENIFATI
3bmvA           TDVIYQRFVDGNTSNNPTGDLYDPTHTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWIPQPVENIYASY
3czeA           LAQWLGEVGDIARQRALQTLDSTRHAGWFGQPHLGYTLQGVAERVP-YLQELGVRYLHLLPFLRARAGDN
3bh4A           -------------------VNGTLMQYFEWYTPNDGHWKRLQNDAE-HLSDIGITAVWIPPAYKGLSQSD
1cygA           SDVVYQRFVDGNTSNNPSGALFSSGCTNLRKYCGGDWQGIINKINDGYLTDMGVTAIWISQPVENVFSVM
3czkA           LDSTRH----------AGWFGQPHMLGYSAYADRFATLQGVAERVP-YLQELGVRYLHLLPFLRARAGDN
3czgA           ALQTLDSTRHAGWFGQPHLGYSAYADRFAG------TLQGVAERVP-YLQELGVRYLHLLPFLRARAGDN
1e3xA           -------------------VNGTLMQYFEWYTPNGQHWKRLQNDAE-HLSDIGITAVWIPPAYKGLSQSD
1cgvA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSII
2d73A           PWRTIIVSDDARNILASRITLNLNEPCKIADAASWVKPVKYIGVWWDMITGKGSWAYTDELTSV-----K
1cgwA           DGNPANNPTGAAFDGTCTNLRLYCGGDWQ-----GIINKINDG----YLTGMGVTAIWISQPVENIYSAY
1b0iA           ------------------PTTFVHLFEWN--------WQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQ
3czlA           LDSTRHAGW----------FGQPHMLGYSAYADRFATLQGVAERVP-YLQELGVRYLHLLPFLRARAGDN
1ea9C           DAIFYQPERFANGDTRNDPEGTLPWGSADPTPCFFGGDLQGVIDHLDHLSKLGVNAVYFTPLFKATTN--
1a47A           TDVIYQRFVDGNTSNNPTGDLYDPTHTSLKKYFGG-DWQGIINKINDYLTGMGVTAIWISQPVENIYAVL
1c7tA           HKKDAVLRLLDQMAAYKLNKFHFHLSDDEGWRIEI-----------PGLPELTEVGGQRCHDLSETTC--
1bliA           -------------------LNGTLMQYFEWYMPNDGHWKRLQNDSA-YLAEHGITAVWIPPAYKGTSQAD
4cgtA           TDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDN----YFSDLGVTALWISQPVENIFAAY
1dtuA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSII
1cxlA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSII
1cgyA           DGNPANNPTGAAFDGTCTNLRLYCGGDWQ---------GIINKINDGYLTGMGVTAIWISQPVENIYSII
1cdgA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSII
1bf2A           SYRTTDSGIYAPKGVVLVPSTQSTTEQDTSIPAQYRGTYYGAGLKASYLASLGVTAVEFLPVQETQNDNY
1d3cA           TDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDG----YLTGMGVTAIWISQPVENIYSAY
3bakA           ----------------QGRTSIVHLFEWRWVDI-------ALECER-YLAPKGFGGVQVSPPNENVAIPW
2cpuA           --------------TQQGRTSIVHLFEWRWVDI-------ALECER-YLAPKGFGGVQVSPPNENVAIPW
1aqmA           ------------------PTTFVHLFEWN--------WQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQ
1avaA           -------------------LFQGFNWESWKHNGG--WYNFLMGKVD-DIAAAGITHVWLPPASQSVAE--
2aaaA           ----------------TQSIYFLLTDRFGRTDNCGGSWQGIIDHLD-YIEGMGFTAIWISPITEQLPQDT
1d7fA           DGNPANNPTGAAFDGSCTNLRLYCGGDWQ---------GIINKINDGYLTGMGITAIWISQPVENIYSVI
3dhuA           -------------------IYSVFVRNYSEAG----NFAGVTADLQ-RIKDLGTDILWLLPINPIGEVLG
2c7fD           ------------IYGSFVEHLGRAVYDLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNY-F
3dhpA           ----------------QGRTSIVHLFEWRWVDI-------ALECER-YLAPKGFGGVQVSPPNENVAIPW
2dh3B           ------SELPAQKWWHTGALYRIGDLQAFQGHGAG-NLAGLKGRLD-YLSSLKVKGLVLGPIHKNQ---K
3dhuB           -------------------IYSVFVRNYS----EAGNFAGVTADLQ-RIKDLGTDILWLLPINPIGEVLG
1c7sA           HKKDAVLRLLDQMAAYKLNKFHFHLSDDEGWRIEI-----------PGLPELTEVGGQRCHDLSETTC--
2c8nD           -----------RIYGSFVEHLGRAVYDGLYQGNSKSDEDGFRKDVIELVKELNVPIIRYPGGN-FVSNYF
3blpX           ----------------QGRTSIVHLFEWRWVDI-------ALECER-YLAPKGFGGVQVSPPNENVFRPW
2c7fF           -------------------------------------EDGFRKDVIELVKELNVPIIRYPGGN-FVSNYF
2dh2A           --------------WHTGALYRIGDLQAFQGHG-AGNLAGLKGRLD-YLSSLKVKGLVLGPIHKNQ---K
3blkA           ----------------QGRTSIVHLFEWRWVDI-------ALECER-YLAPKGFGGVQVSPPNENVAIPW
2c8nF           KDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
2c8nE           -------------------------------------EDGFRKDVIELVKELNVPIIRYPGGN-FVSNYF
2dh3A           ---------------HTGALYRIGDLQAFQGHG-AGNLAGLKGRLD-YLSSLKVKGLVLGPIHKNQ---K
1amg-           PNAVRYHGGDEI-------ILQGFHWNVVREAPN--DWYNILRQQAATIAADGFSAIWMPVPWRDFSSWS
2c8nB           -------------------------------------EDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
2c8nA           ------------IYGSFVEHLGRAVYDGLYQPGNKSDEDGFRKDVIELVKELNVPIIRYPG-GNFVSNYF
2c7fB           ------------YGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
3clwA           ---YQEIDNFSASDAWRCAFIGKNWPQEKKEKIADLLFKREFDEKG-NPIGMALTNWRVNIGAGSYENRE
3cnyA           -------------------KWGIAPIGWRNDDIPSIGKDNNLQQLLSDIVVAGFQGTEVGGFFPGPEKLN
2choA           ---------------EIKDYPSVRYRGVVEGFYGTPWSHQARLSQLKFYGKNKMNTYIYGPKD-------
2c7fE           -------------------------------------EDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
2choB           ALQTFAQLLKDGKLPEIKDYPSVRYRGVVEGFYGTPWSHQARLSQLKFYGKNKMNTYIYGPKD-------
3bsgA           --------------------HQVLFQGFNWESWKQSWYNMMMGKVD-DIAAAGVTHVWLPPPSHSVSN--
2c7fC           -------------------------------------EDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
3bshA           --------------------HQVLFQGFNWESWKQSWYNMMMGKVD-DIAAAGVTHVWLPPPSHSVSN--
3dc0A           ------------------------------------SFNTLKNNMK-DIHDAGYTAIQTSPINQVKGNWY
3cc1B           ---------------TPPGWNSWDCYGASVTEEEVLGNAEYAN----HLKKYGWEYIVVDIQWYEPPFAP
1a0dA           AAKVKKGLEIA--KRLGAENYVFWGGREGYETLLNTDMKLELDNAVDYAKEIGFDGQFLIEPKKEPTKHQ
3clwC           ----------------RCAFIGKNWPQEKKEKIADLLFKREFDEKG-NPIGMALTNWRVNIGAGSYENRE
2bfgA           ---------------NGREKFKKNWKFCVGTGRLLALQKEYLDHLKLVQEKIGFRYIRGHGLLSDDV---
3cttA           QVVQEYLELIGRPALPSYWALGFHLSRYEY------GTLDNMREVVERNRAAQLPYDVQHADIDYM----
2bs9A           ---------------NGREKFKKNWKFCVGTGRLGALQKEYLDHLKLVQEKIGFRYIRGHGLLSDDVGIY
1bagA           ----------------PSIKSGTILHAWNW------SFNTLKHNMK-DIHDAGYTAIQTSPINQVKEGNQ
1bplB           ----------------------------------------------------------------------
2c7fA           -------------------------------------EDGFRKDVIELVKELNVPIIRY-PGGNFVSNYF
3b40A           ----------------------------------------------------------------------
3cc1A           ------------------------------------EVLGNAEYAN-HLKKYGWEYIVVDIQWYEPTANS
2droA           CQPDGTKNSWGPAPDGEEYFLALFFARWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRD---NK
1cbyA           ----------------------------------------------------------------------
1bglA           DVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLQVMDEQTMVQDILLMKQNNFNAV-------------
3czjA           ----------------------------------------------------GVNRHEHHPLHGQVMDEQ
1b5tB           CDATPDELRTIARDYWNNGIRHIVALRGDLPPG-SGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAK
3bobA           AGQLVDVRPEGILKCVDRGSDNTRMGGPKMPGGIYARGVTSIEGLK-QITKEVASKGHLPSVHGDHSSDM
2aamC           ---------------------------------------------------FPFDNWLYQLQNADPVEIS
2aamA           ---------------------------------------------------FPFDNYQLQNADPVEIS-S
3a5vA           ----------------GWNTWNKYGCNV--------DEQLILDAAK-AIASSGLKDLGYNYVIIDDCWQK
1cz1A           MTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQWITEQDFKQISNLGLNFVRIPIGYWAFQLLD
2c0hA           GTNLNYNGHHIFLSG--ANQAWVNYARDFGHNQYSKGKSTFESTLS-DMQSHGGNSVRVWLHIEGESTPE
1bxcA           -------------------GLWTVGNVGRDPFGDAVRERLDPVYVGHKLAELGVHGVNLHDEDLIPRGTP
1eceA           GREILDAN------NVPVRIAGINWFGFETCNYVVHGLWRDYRSMLDQIKSLGYNTIRLPYSDDILKPGT
1b5tA           EAAPHLTCIDATPDELRTIARDYWNNGIRDLPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVLLNLK
2aamB           ---------------------------------------------------FPFDLYQLQNADPVEISS-
1chkA           ------------------------------------DMLELVQHYT-DLEPGNILAKYLPALKKVNGSAS
2agaA           ---------------------------------------------------------------GSMESIF
3civA           -------------------IRGMTFGFVGQHGTW--GTDEARASMR-ALAEQPFNWVTLAFAGLME----
1bplA           -------------------LNGTLMQYFEWYMPNDGHWKRLQNDSA-YLAEHGITAVWIPPAYKGTSQAD
2cwtA           ELTGQKPISITQPEGPSFTVTGGNHIEWEKWSVLHNIAFRDGDRLRPIINRASIAEMV------VPYGDP
2cleA           -------------------LNDRREGAFVFVTLGDPGIEQSLKIID-TLIDAGADALELGVPFSDPLAD-
2ckrA           ----------------------------------WFDHCLTDSSLDALAYDWKADIIRLSMYIQEDGYET
1a5sA           --------------------------------LGDPGIEQSLKIID-TLIDAGADALELGVPFSDP-LAD
3coyA           ----------------------------------------------------------------------
2e3zB           -----------------DTFCKAPGKIADGSSGDATDSYNRWREDVQLLKSYGVKAYRFSL-------SW
3bc9A           -------------------YWEMNTGEYATEHPEEALWNLLAERAPE-LAEAGFTAVWLPPANKGMAGHD
3dymA           EVRIENGLLLLN--GKPLLIRGVNRHEHHPLHGQVMDEQTMVQDI-LLMKQNNFNAV-------------
1cbgA           FQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDHRYKEDIGIMKDMNLDAYRFSI-------SW
1ac0A           ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1cqyA           ----------------------------------------------------------------------
1a5bA           -------------FAQLNDRREGAFVPFVT--LGDPGIEQSLKIID-TLIDAGADALELGVPFSDP-LAN
2e3zA           -------------PSIWDTFCKAPGKIADGSSGDATDSYNRWREDVQLLKSYGVKAYRFSL-------SW
3cozB           ----------------------------------------------------------------------
2cliA           -------------FAQLNDRREGAFVPFVT--LGDPGIEQSLKIID-TLIDAGADALELGVPFSDP-LAD
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------TVPSAP
2c3wA           ----------------------------------------------------------------------
1e4mM           ----------------------------------TCDSFSYWQKDIDVLDELNATGYRFSI-------AW
2dkdB           KIDLSIPANVVIARDSRESSPALSMATIDFQSVPNTKYQDFGLFTTPELHYVTRTLNDPDFGKPTEDGYY
3cepA           -----------------------LFAQLNDRREGFVPFVEQSLKIIDTLIDAGADALELGVPFSDPLAD-
1b31A           -----------------------------------------------TLTKNTKNPAIIKA--DFGQLTP
2a6tA           ---------------------------------------FTNATFSQVLDDLSARFILNLPAEE------
2diwA           --------------------------------------------------------------------GS
2cksA           ----------------------------------WFDHCLTDSSLDALAYDWKADIIRLSMYIQEDGYET
1de5A           -------------------------------------------KARNASELRADLEQAMRLIPGPKRLNL
1bksA           ----------------------------------------------DTLIDAGADALELGVPFSDPLA-D
2ej0F           ----------------------------------------------------------------------
3cejA           --------------------------------------------NRHLHFTLVKDRNVATTRDYYFALAH
2c3wD           ----------------------------------------------------------------------
3a21B           -----------------------------------------------------------------VPSAP
2cncA           ---------------------------------------------------------------EFNSITP


                         .         .         .         +         .         .         .:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
2d0fA           HKYDTQDYMAVDPAFGDNSTLQTLINDIHSTANGPKGYLILDGVFDSHPWFDKYNNFSSQGAYESQSSPW
1bvzA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGEQSRYKDWFFIE
3edeA           SGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDVVLSHIGKQHHRVAVQDPYAAQADSENFTKGW
2bhuA           WGYDGAAFYAPYAPYGRPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSS-----
3edfA           SGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDVVLSHIGKHHWWMKDLPTPDWINYGGKFVPTW
3ecqB           HDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIHVNASETYPESKYFNEKILRKNPDGSYSYGWNW
1ehaA           WGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKY-----KTP
2bhyA           WGYDGAAFYAPYAPYGRP-EDLALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDR--------
2bhzA           WGYDGAAFYAPYAPYGRP-EDLALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDR--------
2e8yA           WGYNPLHFFAPEGSYTRKTELKQMINTLHQHGLRVILDVVFNHVYKRNSPFEKTVPGYFFRHDECGKPSN
1eh9A           WGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTF
1cgtA           HGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFENGRLYDNGTLVGGYT
1cguA           HGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFENGRLYDNGTLVGGYT
6cgtA           HGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAETDTSFAENGRLYDNGTLVGGYT
1cgxA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPSSDQPSFAENGRLYDNGTLLGGYT
3ecqA           HDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIHVNASETYPESK---YFNEKILRKNPDGSYSYG
3eddA           SGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDVVLSHIGKHHWWMKDLPTPDWINYGGKFVPTW
1bvnP           WERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCAVPYSAWDFNDGKCKTASGGIESYN
1dhkA           WERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCAVPYSAWDFNDGKCKTASGGIESYN
2dieA           VGYGAYDLYTVRTKYGTRSQLQGAVTSLKNNGIQVYGDVVMNHKG-GADGTEMVNAVEVNRSNRNQEISG
3cgtA           HGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFENGRLYDNGTLVGGYT
3bmvA           HGYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPASEDPTYAENGRLYDNGTLLGGYT
3czeA           GGFAVSDYGQVEPSLGSNDDLVALTSRLREAGISLCADFVLNHTVPDRYEATLGQVGNFTWVDDTAQWWT
3bh4A           NGYGPYDLYDVRTKYGTKSELQDAIGSLHSRNVQVYGDVVLNHKAGA-DATEDVTAVEVNPANRNQETSE
1cygA           HGYWARDFKKPNPFFGTLSDFQRLVDAAHAKGIKVIIDFAPNHTSPAETNPSYMENGRLYDNGTLLGGYT
3czkA           DGFAVSDYGQVEPSLGSNDDLVALTSRLREAGISLCADFVLNHTADDHYYHHFADRTVPDRYEATLGQVF
3czgA           DGFAVSDYGQVEPSLGSNDDLVALTSRLREAGISLCADFVLNHTADDHYEATLGQVGNFTWVDDTAQWWT
1e3xA           NGYGPYDLYDVRTKYGTKSELQDAIGSLHSRNVQVYGDVVLNHKA-GADATEDVTAVEVNPANRNQETSE
1cgvA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASDQPSFAENGRLYDNGTLLGGYT
2d73A           LGETDYSKTKNGKHSANTANVKRYIDFAAAHGFDAVLVEGWNEGWDFVTPYPDFDVKEIHRYAARK---G
1cgwA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASDQPSFAENGRLYDNGTLLGGYT
1b0iA           WTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAFPIYSPQDFHESCTINNSDYGNDRY
3czlA           GGFAVSDYGQVEPSLGSNDDLVALTSRLREAGISLCADFVLNHTADDHRYEATLGQVPGNFTWVDDTAQW
1ea9C           HKYDTEDYFQIDPQFGDKDTLKKLVDLCHERGIRVLLDAVFNHSGRTFPPFVDVLKNGVVDGIPTYDTFA
1a47A           HGYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPASEDPTYAENGRLYDNGTLLGGYT
1c7tA           LLPQYGQGPDVYGGFFSRQDYIDIIKYAQARQIEVIPEIDMPALHAAGKEQEANEFRLVDQTDTSNTTSV
1bliA           DLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGAATEDVTAVEVDPADRNRVISGEH
4cgtA           HGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAAENGRLYDNGTLVGGYLENGIYK
1dtuA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPSPDQPSFAENGRLYDNGTLLGGYT
1cxlA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQNLFHHNGGTDFSTTENGIY
1cgyA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFENGRLYDNGTLLGGYT
1cdgA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFENGRLYDNGTLLGGYT
1bf2A           WGYMTENYFSPDRRYGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGGYSWRGLDNATYYELTSGNQYFY
1d3cA           HGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFHNGGTDFSTTENGIYK
3bakA           WERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSQVRDC
2cpuA           WERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPA
1aqmA           WTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAFPIYSPQDFHESCTINNSDYGNDRY
1avaA           QGYMPGRLYDLASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIDDRPYADGTGNPDTGA
2aaaA           HGYWQQKIYDVNSNFGTADNLKSLSDALHARGMYLMVDVVPDHMGYAGNDVDYSVFDPFDSSSYFHPYCL
1d7fA           HGYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASDDPSFAENGRLYDNGNLLGGYT
3dhuA           SPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSPDSVLATEHPEWFYHDADGQLTNKV
2c7fD           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSD----
3dhpA           WERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPA
2dh3B           DDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYR--------------------------
3dhuB           SPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSPDSV---LATEHPEWFYHDLTNKVG
1c7sA           LLPQYGQGPDVYGGFFSRQDYIDIIKYAQARQIEVIPEIDMPAHARAGKEQEANEFRLVDQTDTSNTTSV
2c8nD           WEDGVGPVEDRPRRLDNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKY------
3blpX           WERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPA
2c7fF           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKY------
2dh2A           DDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGEN-----------------------
3blkA           WERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPA
2c8nF           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSD----
2c8nE           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKY------
2dh3A           DDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYR--------------------------
1amg-           EGYFWHD-FNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPR
2c8nB           WEDGVGPVEDRPRRLDNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKY------
2c8nA           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDA-----CNLLEYCNHPGGSKYS
2c7fB           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNH------PGGSKY
3clwA           AKEVDNSWNDGKYDFTKQAGQQWFMKAARERGMNNFLFFTNSAPYFMTRS------------------AS
3cnyA           AGQWFSSYIIRDGIEKASEAFEKHCQYLKAINAPVAVVSEQTY-TIQRSDTANIFKDKPYFTDKEWDEVC
2choA           DPYHSAPNWRLPYPDKEAAQLQELVAVANENEVDFVWAIHPGQDIKW------NKEDRDLLLAKFEKMYQ
2c7fE           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSD----
2choB           DPYHSAPNWRLPYPDKEAAQLQELVAVANENEVDFVWAIHPGQDIKWNKEDRDLLLAKFEKMYQLGVRVF
3bsgA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSCIFEGGTSDGRLDWGPHMI
2c7fC           WEDGVGPVEDRPRR----LDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDAC--------
3bshA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCADRGIACIFEGGTSDGRLDWGPHMI
3dc0A           WLYQPTSYQIGNRYLGSEEEFKEMCAAAEEYGVKVIVDAVINHTTSDYAAITHGNTQIKNWSDRWDVTQN
3cc1B           LCDEYGRLTNRFPSAKNGAGFKPLSDAIHDLGLKFGIHIRGIPRQAVYENSPVLGSTKTAREIAHTNSIC
1a0dA           YDFDVATALAFLQTYGLKDYFKFNIEANHATLGHTFEHELRVARIHGMLGSVDANQGDMLLGWDTDEPTD
3clwC           AKEVDNSWNDGKYDFTKQAGQQWFMKAARERGMNNFLFFTNSAPYFMTRSASTV----------------
2bfgA           GIYREVEIDGEMKPFYNFTYIDRIVDSYLALNIRPFIEFGFMPKALASGDQTVFYWKGNVTPPKDYNKWR
3cttA           -----DERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKTPLIGEV
2bs9A           REVE---IDGEMKPFYNFTYIDRIVDSYLALNIRPFIEFGFMPKALASGDQTVFYWKGNVTPPKDYNKWR
1bagA           GLYQPTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHEVKSIPNWTHGNTQIKNWSDRWDVTQN
1bplB           ----------------------------------------------------------------------
2c7fA           WEDGVGPVEDRPRRLDLQVGINEFAKWCKKVNAEIMMAVNLGTRGISD-----ACNLLEYCNHPGGSKYS
3b40A           ----------------------------------------------------------------------
3cc1A           PLCDEYGRLNRFPSAKNGAGFKPLSDAIHDLGLKFGIHIRGIPRQAVYENSPVLGSTKTAREIAHTNSIC
2droA           LIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREGLAPEYAYYDGTPNDEKGYGSCSYR
1cbyA           ----------------------------------------------------------------------
1bglA           -------------RCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMV
3czjA           TMVQDILLMKQNNRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMV
1b5tB           KRKVDAGANRITQFFFDVESYLRFRDRCVSAGIDVEIIPGPVSNFKQAKKFADMTNVRIPAWMAQMFDGL
3bobA           LGCGFFKLWVTGRFDDMGYPRPQFDADQGANAVKDAGGIIEMHHG-SHTEKVVYINLEPNENDQRFIVDG
2aamC           SSGFEIAVIDYSKDGSESGEYSPEEIKIVDAGVVPVAYVNIGQAEDYRF---YWKESWYTNTPEWLGEED
2aamA           SGFEIAVIDYSKDGSESG-EYSPEEIKIVDAGVVPVAYVNIGQAEDYRF---YWKESWYTNTPEWLGEED
3a5vA           NERESS-KTLLADPTKFPRGIKPLVDDIHNLGLKAGIYSSAGTLTCGGHIASLGYEDIDAKT--------
1cz1A           NDPY---------VQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTL
2c0hA           FDNNGYVT---GIDNTLISDMRAYLHAAQRHNILIFFTLWNGAVKQSTHY---RLNGLMVDTRKLQSYID
1bxcA           RDQIVRRFKRALDETGLKVPMVTGNLFSDPGFKDGGFTSRDPWVRAYAFRKSLETMDLGAELGAEIYVVW
1eceA           NSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDC--------SGQSALWYTSSVSEATWI
1b5tA           RKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSKQAKKFADMTNVRIPAWMAQMFDGL
2aamB           SGFEIAVIDYSKDGSESG-EYSPEEIKIVDAGVVPVAYVNIGQAEDYRF---YWKESWYTNTPEWLGEED
1chkA           TAAKDTVFQQAQNDERDRVYFDPAVSQAKADGLRALGQFAYYDAIVMHG---PGNDPTSFGGIRKTAMKK
2agaA           HEKQEGSLCAQHCLNVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALK
3civA           HPGDPAIAY-GPPVTVSDDEIASMAELAHALGLKVCLKPTVNCRDRGEIRFEKEHGPDLESWEAWFGSYS
1bplA           VGYGAYDLYDVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKG-GADATEDVTAVEVDPADRNRVISG
2cwtA           SPIRSWQNYFATGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPR--EIRNGICMHEEDWGILAKH
2cleA           GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYGVDSVLVADVPVEES
2ckrA           NPRGFTDRM------------HQLIDMATARGLYVIVDWHILTPGDPHYNLDRAKTFFAEIAQRHASKTN
1a5sA           GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGICEQVGVDSVLVADVPVEES
3coyA           ----PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVIFVNPMQFGAYP
2e3zB           SRIIPKGGRSDPVNGAGIKHYRTLIEELVKEGITPFVTLYHWDLPQA-----LDDRYGGWLNKEEAIQDF
3bc9A           VGYGTYDLWTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAEDYSKESGKYLFDEKSWDWT
3dymA           -------------RCSHYPNHPLWYTLCDRYGLYVVDEANIETEGMVPMNRLTDDPRWLPAMSERVTRMV
1cbgA           PRVLPKGKLSGGVNREGINYYNNLINEVLANGMQPYVTLFH-----WDVPQALEDEYRGFLGRNIVDDFR
1ac0A           ----------------------------------------------------------------------
1bqcA           NTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQG
1cqyA           ----------------------------------------------------------------------
1a5bA           GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFPVEESAPFRQAALRHN
2e3zA           SRIIPKGGRSDPVNGAGIKHYRTLIEELVKEGITPFVTLYHWDLPQ-----ALDDRYGGWLNKEEAIQDF
3cozB           ----IPAFHPGENVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEVRAAKRVPGSVVVVSIFVNPMQYP
2cliA           GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFVGVDSVLVADVPVEES
3c0uA           --------------------PSETQERLRLLAWLKYADERPEAWLRNDHLGIDLWIELGLPDERRKKACT
2eiyB           ---------------------------------GAFVPQEEAKTSVLSHALHYGTS--VFEG---IRAYE
3a21A           MGWASWNSFAAK---IDYSVIKKQVDAFVAAGLPAAGYTYINIDERDSAGNITVDTAEWPGGMSAITAYI
2c3wA           ----------------------------------------------------------------------
1e4mM           SRIIPRGKRSRGVNEKGIDYYHGLISGLIKKGITPFVTL-----FHWDLPQTLQDEYEGFLDPQIIDDFK
2dkdB           SKLAKSFQEIYTICESNNEKIDITIDAANGV-GAPKIQELLEKYLHKEISFTVVQPNLLNFDCGAD----
3cepA           GPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIPVEESAPFRQAALRHNIAP
1b31A           ENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTV
2a6tA           QSSVERLCFQIEQAHWFYEFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGA
2diwA           SGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGL
2cksA           NPRGFTDRM------------HQLIDMATARGLYVIVDWHILTPGDPHYNLDRAKTFFAEIAQRHASKTN
1de5A           HAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADD-SIRQFWIDHCK
1bksA           GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYGVDSVLVADVPVEES
2ej0F           ---------------------------------GAFVPQEEAKTSVLSHALHYGTS--VFEG---IRAYE
3cejA           WIRTQQHYYDKCPKRVLSLEFYMGRTLQNTMINLGLQNACDEA---------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           MGWASWNSFAAK---IDYSVIKKQVDAFVAAGLPAAGYTYINI---DEGWWQGTRDSAGNITVDTAEWPG
2cncA           ENCMKWGVLRDAQGQWNWKDADAFVAFGTKHNLHMVGHTLVWHSQIHDE--VFKNADGSYISKAALQKKM


                         .         *         .         .         .         .         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIA
2d0fA           YNYYTFYTWPDSYASFLGFNSLPKLNYGNNSNSVAKTYLNPPYSVDGWRLNAAQYVDANGNNGSDVTNHQ
1bvzA           DFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFWMEQGIDGWRLDVANEVD--------HA
3edeA           FVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGYSDGA------------------------
2bhuA           --AWGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATPYMTD--------------------DSETH
3edfA           FVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGYSDG------------------------A
3ecqB           LDQGINIDAAYDLAHGRLARWEDLKKKLGDGLDFIYVDVWGNGQSGDN----GAWATHVLAKEINKQGWR
1ehaA           WGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAES
2bhyA           --FSSAWGGLDYAEPHRRYVTGNARWLRDYHFDGLRLDATPYTDDSETH---------------------
2bhzA           --FSSAWGGLDYAEPHRRYVTGNARWLRDYHFDGLRLDATPYTDDSETH---------------------
2e8yA           GTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGILTVLYMKEKATKAKPGILLFGEGWDLAT
1eh9A           NFDDAESD-----EVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVH----------
1cgtA           NDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNAT------IDKYFKDAIKLWLDMGVDGIRVDAVK
1cguA           NDTNGYFHHNGGSDFSSLENGIYKNLYDLADFN-HNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLG
6cgtA           NDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNAT------IDKYFKDAIKLWLDMGVDGIRVDAVK
1cgxA           NDTQNLFHDLNHNTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
3ecqA           WNWLDNIDAAYDLAHGRLARWEDLKKKLGDGLDFIYVDVWGNGQSGDN----GAWATHVLAKEINKQGWR
3eddA           FVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGYSDGAFLTEYTRRLMAEYPRLNMVGQEWS
1bvnP           DPYQVLDLALEKDYVRSMIADYLNKLI-DIGVAGFRLDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPF
1dhkA           DPYQVRDLALEKDYVRSMIADYLNKLI-DIGVAGFRIDASKHMWP--------GDIKAVLDKLHNLNTNW
2dieA           EYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTKAWDWEVDIENGNYDYLMYA
3cgtA           NDTNGYFHHNGGSDFSSLENGIYKNLYDLADFN-HNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLG
3bmvA           NDTNGYFHHYGGTDFSSYEDGIYRNLFDLADLN-QQNSTIDSYLKSAIKVWLDMGIDGIRLDAVKHMPFG
3czeA           TFYPYQWD--LNWSNPAVFGDALALRLANLGVEAFRLDST------------AYLWKRIGTDCNQSEAHT
3bh4A           EYQIKAWTDFRFPGRGNTYSDFKWHWYHFDGADWDESRKISRIFKFRGEGKAWDWEVSSENGNYDYLMYA
1cygA           NDANMYFHHNGGTTFSSLEDGIYRNLFDLADLN-HQNPVIDRYLKDAVKMWIDMGIDGIRMDAVKHMPFG
3czkA           PHTAPGDLNWSNPAVFGDMALAMLRLA-NLGVEAFRLDSTAYLWKRIGTDCMNQS-----------EAHT
3czgA           TFYPY--QWDLNWSNPAVFGDALALRLANLGVEAFRLDST------------AYLWKRIGTDCNQSEAHT
1e3xA           EYQIKAWTDFRFPGRGNTYSDFKWHWYHFDGADWDESRKISRIFKFRGEGKAWDWEVSSENGNYDYLMYA
1cgvA           NDTQNLFLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
2d73A           IKMMMHHETSASVRNYERHMDKAYQFMADNGYNSVKSGYVGNIIPRGEHHYGQWMNNHYLYAVKKAADYK
1cgwA           NDTQNLDLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
1b0iA           RVQGLADLDTASNYVQNTIAAYINDLQ-AIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGG
3czlA           MWTYQWDLNWSNPAVFGDMALAMLRLA-NLGVEAFRLDSTAYLWKRIGTDCMNQS-----------EAHT
1ea9C           FEPLMPKLNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVANEVSHQFWREFRRVVKQANP----------
1a47A           NDTNGYFHHYGGTDFSSYEDGIYRNLFDLADLNQQN-STIDSYLKSAIKVWLDMGIDGIRLDAVKHMPFG
1c7tA           QFFNRQSLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKT--WHFGGDDAKNIRLGAGYTDKAKPEPGKGI
1bliA           LIKAWTHFHFPGRGSTYSDFKWKLNRIYKFQGKAWDWEVSNEFGNYDYLMYADIDYDHPDVAAEIKRWGT
4cgtA           NLYDLADFNHNNATIDKYFKDAIKLWL-DMGVDGIRVDAVKHMPL------------------------G
1dtuA           NDTQNLDLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
1cxlA           KNLYDLALNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
1cgyA           NDTQNLDLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
1cdgA           NDTDLADLNHNNSTVDVYLKDAIKMWLD-LGIDGIRMDAVKHMPF--------GWQKSFMAAVNNYKPVF
1bf2A           DNTGIGAFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASVLGNSCLNGAYTASAPNCPNGGYNFAINR
1d3cA           NLYDLADLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMNAVKHMPF--------GWQKSFMAAVNNYKPVF
3bakA           RLTGLLDLALEKDYVRSKIAEYMNHLID-IGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPF
2cpuA           VPYSLLDLALEKDYVRSKIAEYMNHLI-DIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPF
1aqmA           RVQNCADLDTASNYVQNTIAAYINDLQ-AIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVI----
1avaA           DFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGY-----------SADVAKIYIDRSEPSF
2aaaA           ITDWDNLTMVEDCWEGDTIVSLPDLDTTETAVRTIWYDWVA------------DLVSNYSVDGLRIDSVL
1d7fA           NDTQNLDLNHNNSSVDVYLKDAIKMWL-DLGVDGIRVDAVKNMPF--------GWQKSFMATINNYKPVF
3dhuA           GDWSDKDLDYGHHELWQYQIDTLLYW--SQFVDGYRCDVA-PLVPLDFWLEARKQVNAKYP---------
2c7fD           --MRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
3dhpA           VPSGLLDLALGKDYVRSKIAEYMNHLI-DIGVAGFRIDASKHMAPGDIKAILDKLHNLNSNWFPEGSKPF
2dh3B           --GENSWFSTQVDTVATKVKDALEFWL-QAGVDGFQVRDIENLKDASS----------------------
3dhuB           DWSDVKDLDYGHHELWQYQIDTLLYW--SQFVDGYRCDV-APLVPLDFWLEARKQVNAKYPETLWLAESA
1c7sA           QFFNRQSLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKTWKNIRLGAGYTDKAKPEPGKGIIDQSNEDKP
2c8nD           SDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
3blpX           VPYSGLDLALGKDYVRSKIAEYMNHLI-DIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPF
2c7fF           SDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSS-----
2dh2A           -----SWFSTQVDTVATKVKDALEFWLQ-AGVDGFQVRDIENLKDASS----------------------
3blkA           VPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLEYMNHLIDIGVAGFRISKHMWPGDIKAILD
2c8nF           --MRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
2c8nE           SDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
2dh3A           --GENSWFSTQVDTVATKVKDALEFWL-QAGVDGFQVRDIENLKDASS----------------------
1amg-           FIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSF----------
2c8nB           SDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
2c8nA           D-MRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
2c7fB           SDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
3clwA           TVSTDQDCINLQNDKFDDFARFLVKSAQHFREQGFHVNYISPNNEPNGQWHANSFQEGSFATKADL--YR
3cnyA           KGLNHYGEIAAKYGLKVAYHHHGTGIQTKEETDRLANTDPKLVGLLYDTGHIAVSDGDYALLNAHIDRVV
2choA           LGVRSFAVFFDDISGEGTNPQKQAELLNYIDEKFAQVK---------PDINQLVMCPTEYNKSWSNPNGN
2c7fE           --MRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
2choB           FDDISGEGTNPQKQAELLNYIDEKFAQVKPDINQLVMCPTEYNKSWSNPNGNYLTTLGDKLNPSIQIMWT
3bsgA           CRDAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA-RGYSPEMAKVYIDGTSPSLAVAEV-----
2c7fC           -----NLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWC----LGNAMDGPWQVGHKTMDEYGRIAEETAR
3bshA           CRDDTKDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMAT
3dc0A           SLLGLYDWNTQNTQVQSYLKRFLERAL-NDGADGFRYDAAKHIELPDDGNYGSQFWPNITNTSAEF----
3cc1B           PWNTDYGVDPTKEGAQSYYNSLFELYA-QWGVDFVKVDDIAAS----RLYDTHLEEIKIQRAIQACGRPV
1a0dA           LYSTTLAMYLGRFDAKVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLDRVFDEFIEERYKSYTEGIGRE
3clwC           --STDQDCINLQNDKFDDFARFLVKSAQHFREQGFHVNYISPNNEPNGQWHANSFQEGSFATKADL--YR
2bfgA           DLIVAVVSHFI-ERYGIEEVRTWLFEVWNAPNLVNFWKDANKQEYFKLYEVTARAVKSVDPHLQV--GGP
3cttA           WPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNP---------
2bs9A           DLIVAVVSHFIERYGIEEVRTWLFEVWNEPNLVNFWKDANKQEYFKLYEVTARAVKSVDPHLQVGGPAIC
1bagA           SLLGLYDWNTQNTQVQSYLKRFLERAL-NDGADGFRFDAAKHIELPDDGSYGSQFWPNITNTSAEFQYGQ
1bplB           ------DIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIKFSFLRDWVNHVREKTG----------
2c7fA           DMRIKH-GVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPT
3b40A           --------------------------------------------------------------------FD
3cc1A           PWNTDYGVDPTKEGAQSYYNSLFELYA-QWGVDFVKVDDIAASRLYDTHLEEIKIQR-------------
2droA           VAANIGLDAEGGSEWSAEEINKIQAFFADKEPEDYRRYKI------------------------------
1cbyA           ----------------------------------------------------------------------
1bglA           QRDRNH--------------PSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIIC
3czjA           QRDRNHP--------------SVIIWSLGTESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIIC
1b5tB           DDDAETRKLVGANIAMDMVKILSREGVKDFHFYTNRAEMSYAICHTLGVR--------------------
3bobA           WAADKFGLDVPKFATVEMLGGPKNAKIV------------------------------------------
2aamC           PAWPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRS--------AARKIN
2aamA           PAWPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARK--------IN
3a5vA           ---------------------WAKWGIDYLKYDNCYNQGQSGTPKLSYDRYKAMGNALNKTGRPMLYSLC
1cz1A           NVLNTIFKKYGGN--EYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFG
2c0hA           HALKPMANALKNKALGGWDIMNEPEGEIKPGESSSEPCFDTRHLSGSGAGWAGHLYSAQEIGRFVNWQAA
1bxcA           PGREGAEVEATGKARKVWDWVREPLNFMAAYAEDQGYGYRFALEPKPNEPRGDIYFATVGSMLALIHTLE
1eceA           SDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDW---------------------RLAAERAGN
1b5tA           DDDAETRKLVGANIAMDMVKILSREGVKDFHFYTNRAEMSYAICHTLGVR--------------------
2aamB           PAWPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRR--------SAARKIN
1chkA           ARTPAQGGDETTYLNGFLDARKAQRVFLKAGNLDLNPPLKWKT---------------------------
2agaA           VWPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDT------------------
3civA           DMMAHYAHVAKRTGCEMFCVGCEMTTAEPHEAMWRETIARVRTEYDGLVTYNCNHGREEHVRFWDAVDLI
1bplA           EHLIKAWTHFHFPGRGSTYSDFKWHW---YHFDGTDWDRKLNRIYK------------------------
2cwtA           SDLWSGINYTRRNRRMVTTIGNDYGFYWYLYLDGTIEFEAKATGVVFFPEGGSDNISQLAPGLGAPHIFS
2cleA           APFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVS
2ckrA           VLYEIANEPNGVSWASIKSYAEEVIPVIRQRDPDSVIIVGTRGWSSLGVSEGSGPAEIAANPVNASNIMY
1a5sA           APFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENLIEKLKE------------
3coyA           RTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPD
2e3zB           TNYAKLCFESFGDLVQNWITFNEPWVISVM----------GYGNGIFAPGHVSNTEPWIVSHHIILAHAH
3bc9A           YNWDEDDVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAV-----KHIDYRFIDKW--------------
3dymA           QRDRNHP--------------SVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIIC
1cbgA           DYAELCFKEFG-DRVKHWITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYAAHYQLLAHA
1ac0A           ----------------------------------------------------------------------
1bqcA           EEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASD
1cqyA           ----------------------------------------------------------------------
1a5bA           IAPIFICPPNADDDLLRQVASYGRGYTYLLIEKGFGISSPEQV---------------------------
2e3zA           TNYAKLCFESFGDLVQNWITFNEPWVISVMG----------YGNGIFAPGHVSNTEPWIVSHHIILAHAH
3cozB           RTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLALEGGPRPTHFAGIVRPDRVFFGEKDYQQQ
2cliA           APFRQAALRHNLLRQVASYGRGYTYLLSRSGVTGHLIEKLKEYHAA------------------------
3c0uA           QAAEVALFTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQ-LAKVSAFADRTTLQATIQDGVIWLSD--
2eiyB           TAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELE-EAIKEVVRRN-GYRSCYIRPLAWMGAKAL-GVN
3a21A           HSKGLKAGIYTDAGKDGCGYYYPTGRPA-APGSGSEGHYDQDMLQFSTWGFDFVKVGDAEGLDAATTYKS
2c3wA           ----------------------------------------------------------------------
1e4mM           DYADLCFEEFGDSVKYWLTINQLYSVPTRGYGSALDAPGRCSPTVDPSCYAGNSSTEPYIVAHHQLLAHA
2dkdB           ----------------------------------------------------------------------
3cepA           IFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHL------------------------
1b31A           MTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVN
2a6tA           IMLDMSMQQCVLVKGWKASSGWGFPKGKIDK---------------------------------------
2diwA           YVIDSIVRQSRHQDDKSKIVRVLNLWQKNN---VFKSEIIQPL---------------------------
2cksA           VLYEIAN--EPNGVSWASIKSYAEEVIPVIRQRDPDSVIIVGTRGWSSLGVSEGSGPAEIAANPVNASNI
1de5A           ASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLRQRLLAALDEVISEKLNPAHHIDAVESK-------
1bksA           APFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALPLHHLIEKLKEYHAA------------
2ej0F           TAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELE-EAIKEVVRRNGY-RSCYIRPLAWMGAKAL-GVN
3cejA           ----------------------------------------------------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           GMSAITAYIHSKGLKAGIYTDAGKDGRPAAPGSGSEGHYDQDMLQFSTWGFDFVKVDWCGGLDAATTYKS
2cncA           EEHITTLAGRYKGKLAAWDVVNEAVGDDLKMRDSHWYKIMGDDFIYNAFTLANEVDPKA---------HL


                         .         .         .         .         *         .         .:420
query           FLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
2d0fA           IWSEFRNAVKGVNSNAAIIGEYWGNAN----PWTAQGNQWDAATNFDGFTQPVSEWITGKDYQNNSASIS
1bvzA           FWREFRRLVKSLNPDALIVGEIWHDASGWL-----MGDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
3edeA           FLTEYTRRLMAEYPRLNMVGEEWSTRVPVVARWQRGKANFDYTSHLPSLMDFPLVDAMRNALSKTGEENG
2bhuA           ILTELAQEIHELGGTHLLLAEDHRNLPDLVTVN-----HLDGIWTDDFHHETRVTLGQFWAVKGEEHERG
3edfA           FLTEYTRRLMAEYPRLNMVGQEWSTRVPVVARWQRGKANFDYTSHLPSLMDFPLVDAMRNALSKTGEENG
3ecqB           FAIE----------------WGHGGEYDSTFHHWAADLTYGGYTNKGINSAITRFI-------RNHQKDA
1ehaA           DLNDPRVVNPKEKVGYNIDAQWVDDFHHSIHAYERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTH
2bhyA           ILTELAQEIHELGGTHLLLAEDHRNLPDLVT-----VNHLDGIWTDDFHHETRVTLTGEQEGYYAGYRGG
2bhzA           ILTELAQEIHELGGTHLLLAEDHRNLPDLV-----TVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYRGG
2e8yA           PLPHEQKAALANAPRMPGIGFFNDMFRDAVKGNTFHLKATGFLGNGESAQAVMHGIAGSSGWKALAPIVP
1eh9A           ------------KYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNL
1cgtA           HMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYA
1cguA           WQKSWMSSIYAHKPVFTFGEWFLGSAAS-----DADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYA
6cgtA           HMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYA
1cgxA           TFGEWFLGVNEVSPENHKFANE--SGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
3ecqA           FAIEWG-----------HGGEYDSTFHH-----WAADLTYGGYTNKGINSAITRFIRNHKDAWVGDYRSY
3eddA           TRVPVVARWQR-----------------------GKANFDGYTSHLPSLMDFPLVDAMRNALSKTGEENG
1bvnP           IFQEV-----IDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALV
1dhkA           FPAGSRPFIVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALV
2dieA           DIDMDHPEVINELRNWGVWYTNTLNLD-------GFRIDAVKHIKYSYTRDWLTHVRNTTGKPMFAVAEF
3cgtA           WQKSWMSSIYAHKPVFTFGAWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNT-SNMYALDSM
3bmvA           WQKNFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTDTMYGLDSMI
3czeA           LLVALRAVTDIVA-PAVVKAEAIVPTQLPPYFGSDEGHECHLAYHSTLAAGWSALALQRGDILHNVIAHS
3bh4A           DVDYDH---PDVVAETKKWGIWYANELSLDGFRIDAAKHIKFSFLRDWVQAVRQATGKEMFTVAEYWQNN
1cygA           WQKSLMDEIDNYRPVFTFGEWFLSENEVDANNHYFANESGMSLLDFRFGQKLRQVLRNNS-DNWYGFNQM
3czkA           LLVALRAVTDIVAPAVVMKAQAIVPMTQLPPYFVDEGHECHLAYHSTLMAAGWSA--LALQRGDILHNVI
3czgA           LLVALRAVT-DIVAPAVVKAEAIVPTQLPPYFGVDEGHECHLAYHSTLAAGWSALALQRGDILHNVIAHS
1e3xA           DVDYDHPDVVAETKKWGIWYANELSLDGFRIDAAKHIKFSFLRDWVQAVRNNAGKLENYLNKTSFNQSVF
1cgvA           TFGEWFLGVNEVSPENHKFANE--SGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
2d73A           IMVNA--------HEATRPTGICRTYPNLIGNESARGTEYEFGGNKVYHTTILPF--TRLVGGPMDYTPG
1cgwA           TFGEWFLGVNEVSPENHKFANE--SGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
1b0iA           --------------EAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVF---
3czlA           LLVALRAVTDIVAPAVVMKAQAIVPMTQLPPYFVDEGHECHLAYHSTLMAA--GWSALALQRGDILHNVI
1ea9C           --------------DAYILGEVWHESSIWL-----EGDQFDAVMNYPFTNAVLDFFIHQIADAEKFSF-M
1a47A           WQKNFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTDTMYGLDSMI
1c7tA           IDQSNEDKPWAKSQVCQTMIKEGKFGQEVSKLVKAHGIDRMQAWQDGLKDAESSKAFATSRVGVNFWDTL
1bliA           WYANIKFSFLRDWVNHVREKTGKEMFTVAEYWSYDLGALENYLNKTNFNHSVFDVPLHYQFHAASTGGGY
4cgtA           WQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNM-YALDSM
1dtuA           TFGEWFLGVNEVSPENHKFANE--SGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
1cxlA           TFGQWFLGVNEVSPENHKFANES--GMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
1cgyA           TFGEWFLGVNEVSPENHKFANE--SGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
1cdgA           TFGEWFLGVNEVSPENHKFANES--GMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
1bf2A           ILREFTVRPAAGGSGLDLFAE---PWAIGGNSYQLGGFPQGWSEWNGLFRDSLRQAQNELGSMTIYVTQD
1d3cA           TFGQWFLGVNEVSPENHKFAN--ESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQV
3bakA           IYQE-----VIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALV
2cpuA           IYQEVI-----DLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDR---
1aqmA           ----------DQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFV--
1avaA           AVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVE-GELWRLRGTDGK
2aaaA           EVQPDFFPGYNKASGVYCVGEI---DNGNPASDCPYQKVLDGVLNYPIYWQLLYAFESSSGSISNLYNMI
1d7fA           TFGEWFLGVNEISPEYHQFANE--SGMSLLDFRFAQKARQVFRDNTDNMYGLKAMLEGSEVDYAQVNDQV
3dhuA           ------ETLWLAESAGSGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLLQ
2c7fD           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
3dhpA           IYQEVI-----DLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSALKNWGEGAGFMPSDRAL-
2dh3B           FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLL---------TSSYLSDSGSTGEHTKS--
3dhuB           G---------------SGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLLQ
1c7sA           WAKSQVCQTMIKEGKVADMEHLPSYFQEVSKLVKAHGIDRMQAWQDGLKDAESSKAFATSRVGVNFWDTL
2c8nD           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
3blpX           IYQEVI-----DLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALV
2c7fF           -----KDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKK
2dh2A           FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLL---------TSSYLSDSGSTGEHTKSLV
3blkA           KLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYF--GNGRVTEFKYGAKLGTVIKWNGEKMSYLKNWG
2c8nF           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
2c8nE           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
2dh3A           FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLL---------TSSYLSDSGSTGEHTKS--
1amg-           -----------------CVGELWKGPSEYPNWDWRNTASWQQIIK--DWSDRAKCPVFDFALKERMQNGS
2c8nB           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
2c8nA           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
2c7fB           FPQWEATV----------LDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKK
3clwA           MVEELDKAISEAQIDTKILIPEVGDMKYLFEIDSIAKTPDDIIHSMFYKDGQYSVLKFKNLFNCVAAHDY
3cnyA           HVHFKDVRRSKEEECRAKGLTFQGSFLNGFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPL
2choA           YLTTLGDKLNPSIQIMWTGDRVISDITRDGISWINERIK---RPAYIWWNFPVSDYVRDHLLLGPVYGND
2c7fE           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSF
2choB           GDRVISDITRDGISWINERIKRPAYIWWNFPV-SDYVRDHLLLGPVYGNDTTIAKEMSGFVTNPMEHAES
3bsgA           WDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDF-----TTKGILNAAVEGELWRLIDPQGK
2c7fC           AMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDSLHQYYGNKENDTADFLAKSDDLDDFIRSV
3bshA           GGDGKPN------YDQDAHRQNLVNWVDKVGGAASAGMVFDF-----TTKGILNAAVEGELWRLIDPQGK
3dc0A           -------QYGEILQDSASRDAAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSADKLVTW---
3cc1B           LSLSPGPAPIKWRITDDFWDDWSLLYQFERCEVWEKHIGTGHWPDCGLPLGHIGIRSVDGPGGDRWTRFT
1a0dA           IVEGTADFHKL-----------------------------------------------------------
3clwC           MVEELDKAISEAQIDTKILIPEVGDMKYLFEIDSIAKTPDDIIHSMFYKDGQYSVLKFKNLFNCVAAHDY
2bfgA           AICGGSDEWITDFLHFCAERRVPVDFVSRHAYTSKAPHKKTFEYYYQELEPPEDMLEQFKTVRALIRQSP
3cttA           -------------PFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFI
2bs9A           GGSDEWITDFLHFCAERRVPVDFVSRHAYTSKAPHKKTFEYYYQELEPPEDMLEQFKTVRALIRQSPFPH
1bagA           I-----------LQDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSADKLVTWV--
1bplB           -------------KEMFTVAEYWQNDLGAL---------ENYLNKTNFNHSVFDVPLHYQFHAASTQGGY
2c7fA           FPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIK-----AKKRSKKD
3b40A           SRITVPLDFGTTGNEVDKDGPGQLDLVKAGRGRLSGAALAIFGWPEMWPHKPTPGFVDEARHQQEIRYKI
3cc1A           ---AIQACGRPVLSLSPGPAPIKYAHHFKTNANWRITDDFWDDWSLLYQFERCEVWEKHIGTGHWPDCGL
2droA           ----------------------------------------------------------------------
1cbyA           -----------------------------------------------------------PIIRKFKHIVL
1bglA           PMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDW
3czjA           PMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRQGGFVWDWV
1b5tB           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2aamC           FVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLFYLK----------TIPLEENETKS
2aamA           FVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLKTIPLEENETKSRLEYLIRLNRKGK
3a5vA           -------------------------NWGEDGPWNFASTISNSWRISGYDNFNRPDPACPCTTYDCVLAGF
1cz1A           YWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNV-----AGEWSAALT
2c0hA           AIKEVDPGAMVTVGSWNMKADTDAMGFHNLYSDHCLVKAGGKQSGTLSFYQVHTYDWQNHFGNESPFKHS
1bxcA           RPERFG-------------------LNPEFAHETMAGLNFVHAVAQALDAGKLLHIDLNGQRMNRFDQDL
1eceA           AVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPN
1b5tA           ----------------------------------------------------------------------
2aamB           FVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLFYLKTI----------PLEENETKS
1chkA           ----------------------------------------------------------------------
2agaA           YLALFLAQLQQEGYSIFVVKGDLPDCE-------------------------------------------
3civA           SSSAYYPIDRWRDRVPVLRKPLFFMEVGCPSRSGSGACPWDYRHPGAVCLDEQARFYEAMFAAMPDEPWF
1bplA           ----------------------------------------------------------------------
2cwtA           ADMAIDGFTNRVEEEDVVRQTMGPGNE-------------------------------------------
2cleA           ----------------------------------------------------------------------
2ckrA           AFHFYAASHRDNYLNALREASE--LFPVFVTQFGTETYTGDGANDFQMADRYIDLMAERKIGWTKWNYSD
1a5sA           ----------------------------------------------------------------------
3coyA           RV-FFGEKDYQQLVLIRQLVAD------------------------------------------------
2e3zB           AVKLYRDEFKEKQGGQIGITLDSHWLIPYDDTDASKEATLRAMEFKLGRFANPIYKGEYPPRIKKILGDR
3bc9A           ----MSAVQNSSNRDVFFVGEAVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDM--LNGAYMADLRNAG
3dymA           PMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDW
1cbgA           AAARLYKTKYQASQNGIIGITLVSHWFEPASK------EKADVDAAKRGLDFMLGWFMHPLTKGRYPE--
1ac0A           ----------------------------------------------------------------------
1bqcA           PTGNTVFSIHMYGSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYISGNGGG
1cqyA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2e3zA           AVKLYRDEFKEKQGGQIGITLDSHWLIPYDDTDASKEATLRAMEFKLGRFANPIYKGEYPPRIKKILGDR
3cozB           LVADFNLDVAVV--GVPTVREA------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           PLPN------------------------------------------------------------------
3a21A           ISDAVGRAAATTGRPLTLSICN-----------------WGYQNPWNWAAGQAPLWRTSTDIIYYGNQPS
2c3wA           ----------------------------------------------------------------------
1e4mM           KVVDLYRKNYTHQGGKIGPTMITRWFYNDTDRHSIAATERMKEFFLGWFMGPLTNGTYPQIMIDTVGERL
2dkdB           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
1b31A           GMVSHVKKWLAAGIPIDGIGSQT-----------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           MYAFHFYAASHRDNYLNALREASELFPVFVTEFGTETYTGDGANDFQMADRYIDLMAERKIGWTKWNYSD
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           P---------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           ISDAVGRAAATTGRPLTLSICNWGYQNPWNWAAGQAPLWRTSTDIIYYGNQPSMTSLLSNFDQTLHPTAQ
2cncA           MYNDYNIERTGKREATVEMIERLQKRGPIHGLGIQGHLGID-TPPIAEIEKSIIAFAKLGLRVHFTSLDV


                         .         .         +         .         .         .         .:490
query           TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVE
2d0fA           TTSWLRGTRANYPTNVQQSMMNFLSNHDITRFATRSGGDLWKTYLALIFQMTYVGTPTIYYGDEYGMQGG
1bvzA           TRAR-MLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAK----FRLAVLFQMTYLGTPLIYYGDEIGMAGA
3edeA           LNEVYETLSLDYLYPEPQNLVLFGGNHDMARMFSAAGEDFDRWRMNLVFLMTMPRIPQFYSGDEILMTGG
2bhuA           HPSDALEAPNFVYCIQNHDQIGNR--PLGERLHQSDGVTLHEYRGAAALLLTLPMTPLLFQGQEWAASTP
3edfA           LNEVYETLSLDYLYPEPQNLVLFGGNHDMARMFSAAGEDFDRWRMNLVFLMTMPRIPQFYSGDEILMTGG
3ecqB           WVGDYRSYGGAANYPLLG----------GYSKDFEGWQGRSDYNGYVTNLFAHDVTKYFQHFTVSKWENG
1ehaA           GEPVGELDGCNFVVYIQNHDQVGN---RGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENP
2bhyA           AEALAYTIRRGWRYEGAVKGEEHERGHPSDALEAPNFVYCIPLGERLHQSDGVTLHELLFQGQEWAASTP
2bhzA           AEALAYTIRRGWRYEGAVKGEEHERGHPSDALEAPNFVYCIPLGERLHQSDGVTLHELLFQGQEWAASTP
2e8yA           EPSQSINYVESHDNHTFWDKMSF------ALPQENDSRKRSRQRLAVAIILLAQGVPFIHSGQEFFRTKQ
1eh9A           DDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQYKIAAALYLLSPYIPMIFMGEEYGEENP
1cgtA           LDSMINSTATDYNQVNDQ---VTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGN
1cguA           LDSMINSTATDYNQVNDQ---VTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGN
6cgtA           LDSMINSTATDYNQVNDQ---VTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGN
1cgxA           TFID----------------------NHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
3ecqA           GGAANYPLLGGYSKDFEGWQGRSDYNGYVTNLFAHDVTKYFQHFTVSKWENGTPVTTDNGSTYKWTPERV
3eddA           LNEVYETLSLDYLYPEPQNLVLFGGNHDMARMFSAAGEDFDRWRMNLVFLMTMPRIPQFYSGDEILMTGG
1bvnP           FVDNHD------------NQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGE
1dhkA           FVDN------------HDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGE
2dieA           WKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNLNGSVVQKHPIHAVTFVDNHDSQPGE
3cgtA           INSTATDYNQVNDQVTFIDNHDM-------DRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGN
3bmvA           QSTASDYNFINDMVTFIDNH---------DMDRFYNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYMTGN
3czeA           PPLPRHCAWLSYV--RCHDDIGWN--VLQHEACGNAAQPPFSLDVARFYANAVPGSYARGESFVH-----
3bh4A           AGKLENYLNKTSFNQSVFDVPLHFNLQAASSQGGGYVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGT
1cygA           IQDTASAYDEVLDQVTFIDNHDMD-------RFMIDGGDPRKVDMALAVLLTSRGVPNIYYGTEQYMTGN
3czkA           AHSPPLPRHCAWLSYVCHDDIGWN--VLQHEACGNAAQPPFSLRFYANAVPGSYARGESFQGVHGTN---
3czgA           PPLPRHCAWLSYVRCHDDIGWNVHEACGNAAQPPFSLRDVARFYANAVPGSYARGESFGVHGTN------
1e3xA           DVPLHFNLQAASSQGGGYDMRKLLNGTVVSKHPLKSVTTWFKPLAYAFILTRESGYPQVFYGDMYGTKGD
1cgvA           TF------------IDNHD----------MERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
2d73A           IFETHCNKMNPANNSQVRSTIARQLAYSPLQMAADIPENYERFMDAFQFIKDVALDWDETNYLEAEPTIA
1cgwA           TFID------------NHD----------MERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
1b0iA           -------------VDNHDNQRGGGAGNVITFEDGRLY-----DLANVFMLAYPYGYPKVMSSYDFHGDTD
3czlA           AHSPPLPRHCAWLSYVCHDDIGWN--VLQHEACGNAAQ----------PPFSLRDVARFYANAVPGSYAR
1ea9C           LGKQLAGYPRQASEVMFNLLDSHDTARLLTQADGDKRKMK----LAVLFQFTYFGTPCIYYGDEVGLDGG
1a47A           QASDYNFINDMVTFIDNHDM-----------DRFYNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYMTGN
1c7tA           YWGGNDWANKGYEVVVSNPDYVFPYEVNPDERGYYWGTRFSDERKVFSFAPDNMPQNAETSVDRDGNHFN
1bliA           DMRKLLNGTVVSKHPLKSVTFVDNHDTQPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGD
4cgtA           INSTATDYNQVNDQVTFIDNHDM-------DRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGN
1dtuA           TFID------------NHD----------MERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
1cxlA           TFIDNHDM----------------------ERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
1cgyA           TFID------------NHDME----------RFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
1cdgA           TFIDNHDME----------------------RFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
1bf2A           FQSSGRSPWNSINFIDVHDGMTLKDVYGMSAGTGAAVDQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQ
1d3cA           TFIDNHD----------------------MERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGG
3bakA           FVDS------------HDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGN
2cpuA           ----------ALVFVDNHNNQGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGN
1aqmA           --------------DNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYP----YGYPKVMSSYDFHGDTD
1avaA           APGMIGWWPAKAVTFVDNHDTGS--------TQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLK
2aaaA           KSVASDCSDPTLL--------GNFIENHDNPRFAKYTSDYSQAKNVLSYIFLSDGIPIVYAGEEQHYAGG
1d7fA           TFIDNHDME----------------------RFHTSNGDRRKLEQALAFTLTSRGVPAIYYGSEQYMSGG
3dhuA           RQDATFPGNYVKMRFLENHD---------NARMMSLMHSKAEAVNNLTWIFMQRGIPLIYNGQEFLAEHQ
2c7fD           DWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIV
3dhpA           -----------VFVDNHDNQRGHGAGGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGK
2dh3B           LVTQYLNATGNRWCSWSLS----------QARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAA
3dhuB           RQDATFPGNYVK---------MRFLENHDNARMMSLMHSKAEAVNNLTWIFMQRGIPLIYNGQEFLAEHQ
1c7sA           YWGVNDWANKGYEVVVSNPDYVFPYEVNPDERGYYWGTRFSDERKVFSFAPDNMPQNAETSVDRDGNHFN
2c8nD           DEWNVWYHSNNEDANIQNEP-----------WRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACL
3blpX           FVD-------------NHDNQRGHGA---GGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYF
2c7fF           RSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACL
2dh2A           TQYLNATGNRWCSWSLSQARLLTSFPAQLLRLYQLLFTLPGTPVFSYGDEIGLDAAALPGQPEAPVLWDE
3blkA           EGWGFMPSDRALVFVDNHDNQRGHGA---GGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYF
2c8nF           DEWNVWYHSNNE----DANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINV
2c8nE           DEWNVWYHSNNE----DANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINV
2dh3A           LVTQYLNATGNRWCSWSLS----------QARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAA
1amg-           IADWKHGLNGNPDPRWREVAVTTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYG
2c8nB           DWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIV
2c8nA           DEWNVWYHSNNE----DANIMQNEPWRIAPPLLEDIYTFEDA------LLVGLMLITLMKHADRIKIACL
2c7fB           RSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACL
3clwA           WSAYPATLLVDIRNRIHKEANGHNTKFWASEYCILEKNEEITMPASPERSINLGLYVNDLTLANASAWQW
3cnyA           EAQIAHRYIKQHL---------------------------------------------------------
2choA           TT---IAKEMSGFVTNPMEHAESSKIAIYSVAAWNPAKYDTWQTWKDAIRTILPSAAEELECFAMHNSDL
2c7fE           DEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDA----------LLVGLMLITLMKHADRIKIACL
2choB           SKIAIYSVASYAWNPAKYDTWQTWKDAIRTILPSAAEELECFAMHNSDLGPNGHGYRREESMDIQPAAER
3bsgA           APGVMGWWPAKAVTFVNHDT---------GSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFF-----
2c7fC           IATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLM
3bshA           APGVMGWWPAKAVTFVNHD---------TGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFF-----
3dc0A           --------------VESHDTYANDDEE-------STWMSDDDIRLGWAVIASRSGSTPLFFSRPDGGGNG
3cc1B           KDEQLTNLWAICHSPLFGGE--------LRDNDEWTLSLLTNEGILSINQKSVLNRFVYREEDKVAWAAN
1a0dA           ----------------------------------------------------------------------
3clwC           WSAYPATLLVDIRNRIHKELSANGHNTKFWASEYCILEKNEEITMPASPERSINLGLYNDLTLANASAWQ
2bfgA           FPHLPLHITEYNTSYSPINPVHDTALNARILSEGGDYVDSFSYWTFSDVFEEMDVPKALFHGGFGLVALH
3cttA           LTRSTFAGSGKF----------------AAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFPE
2bs9A           LPLHITEYNTSYSPINPVHDTALNAAYIARILSEGGDYVDSFSYWTFSDVFEEMDVPKALFHGGFGLVAL
1bagA           ---------------ESHDTYAND-------DEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNG
1bplB           DMRKLLNSTVVSKHPLKAVTFVDNHDTQPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGD
2c7fA           IYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLIT-----LMKHADRIKIACL
3b40A           LTGMVRDFPNQVGIAYSPEDFMEGKFAIVMSMLN--AYPLGDDLSQLDKW---AARGVRMFGFSYVGNND
3cc1A           PLGHIGIRSVDG-----------------PGGDRWTRFTKDEQLTNLWAICHSPL-----FGGELRDNDE
2droA           ----------------------------------------------------------------------
1cbyA           TVPSSDLDNFNTVFYVQPQYIALHLANAFQGAIDPLNL----NFNFEKALQIANGIPNSAIVKTLNQSQQ
1bglA           VDQSLIKYDENGNPWSAYGGDFQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHS
3czjA           DQSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGDRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFR
1b5tB           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2aamC           RLEYLIRLNRKGKFILSVDYVDDSDSFENISRILDYYEKAKRNGIPYAARSDLELDENVIEGIQP-----
2aamA           FILSVDYVDDGSDS--FENISRIL------DYYEKAK------RNGCIPYAARSDLELDENVIEG-----
3a5vA           RCSVMNIINKAVAVSQKARSGGWNDLDLEVGNGGMNQEEYRVHYTIWAALKSPL-----ILGNDVTNITN
1cz1A           DC---AKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFW-S
2c0hA           FS------NFRLKKPMVIGEFNQEHGA--GMSSESMFEWAYTKGYSGAWTWSRTDV--------------
1bxcA           RFGSENLKAAFLLVDLLESSGYQGPRHFDAHALRTEDEEGVWAFARGCMRTYLILKERAEAFREDPEVKE
1eceA           NMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKT----LVQYLRPTAQYGADSFQWTFWSWNP
1b5tA           ----------------------------------------------------------------------
2aamB           RLEYLIRLNRKGKFILSVDYVDDSDSFENISRILDYYEKAKRNGC--IPYAARSDLELDENVIEG-----
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3civA           KGYMLWEWPWKLREAASEDGSYCIYGKPAEDVVARAFSAIA-----------------------------
1bplA           ----------------------------------------------------------------------
2cwtA           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2ckrA           DFRSGAVFQPGTCASGGPW---------------------------------------------------
1a5sA           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
2e3zB           LPEFTPEEIELVKGSSDFFGLNTYTTHLVQDGGSDELAGFVKTGHTRADGTQLGTQSDMGWLQTYGPGFR
3bc9A           LVNSPGYENRAVTFVDNHDT-DRDEGSYTVSIYSRKYQAYAYILTRA------EGVPTVYWKDYY-----
3dymA           VDQSLIKYDENGNPFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHS
1cbgA           ---SMRYLVRKRLPKFSTEESKELTGSFDFLGLNYYSSYYAAKAPRIPNARPAIQTDSLINATFEHNGKP
1ac0A           ----------------------------------------------------------------------
1bqcA           VEYLDMVYNFDGDLSPWGERIFYGPNGIASTA--------------------------------------
1cqyA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2e3zA           LPEFTPEEIELVKGSSDFFGLNTYTTHLVQDGGSDELAGFVKTGHTRADGTQLGTQSDMGWLQTYGPGFR
3cozB           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           MTSLLSNFDQTLHPTAQHTGYYNDPDMLMVGMDGFTAAQNRTHMNLWAISGAPLLAGNDLTTMTSETAGI
2c3wA           ----------------------------------------------------------------------
1e4mM           PSFSPEESNLVKGSYDFLGLNYYFTQYAQPSPNPVNSTNHTAMMDAGAKLTYINASGHYIGPLFEKDKAD
2dkdB           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           DFRSGAVFQPGTCASGGPW---------------------------------------------------
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           ----------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           HTGYYNDPDMLMVGMDGFTAAQNRTHMNLWAISGAPLLAGNDLTTMTSETAGILKNPEVIAVDQDSRGLQ
2cncA           DVLPSVWELPVAEVSTRFEYKPERDPYTKGLPQEMQDKLAKRYEDLFKLFIKHSDKIDRVTFWGVSDDAS


                         *         .         .         .         .         +         .:560
query           WREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDN
2d0fA           ADPDNRRSFD-WSQATPSNSAVALTQKLITIRNQYPAL------RTGSFMTLITDDTNKIYSYGRFDNV-
1bvzA           TDPDCRRPMI-WEEKEQNRGLFEFYKELIRLRHRLASLTRGNV------RSWHADKQANLYAFVRTVQD-
3edeA           WAGDKANAFSGAGLTSQQRAAQDLVRKLANWRKNQPVI--------HNGRLMHFGPEENTWVYFRYNKD-
2bhuA           FQFFSDHAGELGQASEGRKKEFDVPDPQAEQTFLNSKLNWAEREGRQRENLTTGHDGD-VLWVRTVTGA-
3edfA           WAGDKANAFSGAGLTSQQRAAQDLVRKLANWRKNQPVI--------HNGRLMHFGPEENTWVYFRYNKD-
3ecqB           TPVTTDNGS-TYKWTPERVELVDADNNKVVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDAN
1ehaA           FYFFSDFSDSKLIQG------------VREGRKKENGQDTDPQDESTFNASKLSKIDEEIFSFYKILIKM
2bhyA           FQFFSDHAGAVSEGRKKEFDVPDPQAEQTFLNSKLNWAEREGGEHRQRENLTTGHDGD-VLWVRTVTGA-
2bhzA           FQFFSDHAGDPQAEQTFLNSKLNWAEREGGEHARTLRLYRDVLHNRQRENLTTGHDGD-VLWVRTVTGA-
2e8yA           GVENSYQSSDSIDRRETFKEDVHYIRRLISLRKAHPAFRLRSA-ADIQRHLECLTLKEHLIAYRLYDLDE
1eh9A           FYFFSDFSDSKLIQG--------VREGRKKENGQDTDPQDESTFNASKLSWKIDE---EIFSFYKILIKM
1cgtA           GDPDNRAKM---PSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINN--------DVYVYERKFGKS
1cguA           GDPDNRAKM---PSFSKSTTAFNVISKLAPLRKSNPAI--------AYGSTQQRWINNDVYVYERKFGKS
6cgtA           GDPDNRAKM---PSFSKSTTAFNVISKLAPLRKSNPAIA--------YGSTQQRWINNDVYVYERKFGKS
1cgxA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFG----------
3ecqA           EL-VDADNNKVVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKYYFNTQAG
3eddA           WAGDKANAFSGAGLTSQQRAAQDLVRKLANWRKNQPVIHNGR-----LMHFGPEENT-----WVYFRYNK
1bvnP           DVNDWIGPPVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNR--
1dhkA           DVNDWIGPPVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNR--
2dieA           ALESFVQSWFKPLAYALIYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAYGTQHDYFDHHDISSHP
3cgtA           GDPDNRAKM---PSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERK--------FGKS
3bmvA           GDPYNRAMM---TSFNTSTTAYNVIKKLAPLRKSNPAIAYGTTQQRWINNDVYIYERKFGNNVALVAINR
3czeA           ----------------------------------------------------------------------
3bh4A           SPKEIPSLKDNIEP---------ILKARKEYAYGPQHDYIDHPDVIGWTREGDSSAAKSGLAAL------
1cygA           GDPNNRKMM---SSFNKNTRAYQVIQKLSSLRRNNPALAYGDTEQRWINGDVYVYERQFGKDVVLVAVNR
3czkA           ----------------------------------------------------------------------
3czgA           ----------------------------------------------------------------------
1e3xA           SQREIPALKHKIEP---------ILKARKQYAYGAQHDYFDHHDIVGW-------------TREGDSSVA
1cgvA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKF-----------
2d73A           RKAKDTDDWYVGCTAGNGHTSKLVFDFLTPGKQYIATVYADAKDADWKENPQAYTIKKGILNKSKLNLHA
1cgwA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKF-----------
1b0iA           APVHNNGNL---ECFASNWKCEHRWSYIAGGVDFRNNTAD------NWAVTNWWDNTNNQISFGRGSSGH
3czlA           GESFQVHGTN------------------------------------------------------------
1ea9C           HDPGCRKCME-WDETKHDKDLFAFYQTVIRLRQAHAAL------RTGTFKFLTAEKNSRQIAYLR--EDD
1a47A           GDPYNRAMM---TSFNTSTTAYNVIKKLAPLRKSNPAIAYGTTQQRWINNDVYIYERKFGNNVALVAINR
1c7tA           AKSDKPWPGYGLSAQLWSETQRTDPQMEYMIFPRALSVAERSWHRAGWEQDYRAG--REYKGGETHFVDT
1bliA           SQREIPALKHKIEP---------ILKARKQYAYGAQHDYFDHHDIVGWTREGDSSVANS-----------
4cgtA           GDPDNRAKM---PSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDV--------YVYERKFGKS
1dtuA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDV------------------
1cxlA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWI--------NNDVLIYERKFGSN
1cgyA           TDPDNRARIPSFST---STTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERK------------
1cdgA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKF-----------
1bf2A           CNNNAYNLWLTYSWTTDQSNFYTFAQRLIAFRKAHPALRPSSWSGAVADSNYWNNTSNYAIAYAINSLGD
1d3cA           TDPDNRARI---PSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKF-----------
3bakA           DVNDWVGPPNNNGVIKEVTINPDNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGR-----
2cpuA           DVNDWVGPPVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNR--
1aqmA           A-GGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTN---NQISFGRGSSGH
1avaA           EEIDRLVSVRTRHGIHN--------ESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAH
2aaaA           KVPYNREATW-LSGYDTSAELYTWIATTNAIRKLAIAADSAYITYANDAFYTDSN----TIAMAK--GTS
1d7fA           NDPDNRARLP-SFSTTTTAYQVIQKLAPLRKSNPAIAYGSTHERWINNDVIIYERKFGNNVAVVAINRNM
3dhuA           PSLFDRDTM----VADRHGDVTPLIQKLVTIK-QLPLLRAADYQL--------AVVEEGIVKITYRAAG-
2c7fD           TERNGGAAWRQ--------TIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNE---EK
3dhpA           DVNDWVGPPNDNGVTKEVTITCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGR-----
2dh3B           ALPGQPMEMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD-----FHAFSAGPGL---FSYIRHWDQN
3dhuB           PSLFDRDTMVADRHGDVT----PLIQKLVTI-----------KQLPLLRAADYQLAVVEEGIVKITYRAA
1c7sA           AKSDKPWPGYGLSAQLWSETQRTDPQMEYMIFPRALSVAERSWHRAGWEQDYRAGREYKGGETHFVDTQA
2c8nD           AQLINVIAPIVTE-RNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEE
3blpX           ENGKDVNDWVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGR-----
2c7fF           AQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEK
2dh2A           SSFPDIPGATVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDF-----HAFSAGP---GLFSYIRHWDQN
3blkA           ENGKDVNDWVGPEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGR-----
2c8nF           IAPIVTERN---GGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIY---NEEK
2c8nE           IAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVT------DIESVAIYNEEK
2dh3A           ALPAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD-----FHAFSAGP---GLFSYIRHWDQN
1amg-           DFIRQLIQVRRAAGVR-ADSAISFHSGYSGLVATVSGSQQTNSDLGNPGQVASGSFS-------------
2c8nB           TERNGGAAWRQTIFY--------PFMHASKYGRGIVLQPVINSPLHDTSKHEDV---TDIESVAIYNEEK
2c8nA           AQLINVIAPIVTERNGGAAWRQTPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEE-
2c7fB           AQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEK
3clwA           WTAVSLGEDV-PIQLLPLEGSNGLSLQYDGEISTTKMLWTTAIAIKPTYKISDLEAATSLMISSYTDGK-
3cnyA           ----------------------------------------------------------------------
2choA           GPNGHGYRREE------SMDIQPAAERFLKAFKEGKNYDKADFETLQYTFERMKESADILLMNTENKPLI
2c7fE           AQLINVIAPIVTE-RNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAINEEK
2choB           FLKAFKEGKNYDKADF-ETLQYTFERMKESADILLMNTENKPLIVEITPWVHQFKLTAEMGEEVLKMVEG
3bsgA           ----------------------------------------------------------------------
2c7fC           KHADRIKIAIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEK
3bshA           ----------------------------------------------------------------------
3dc0A           VRFPGKTQI------GDRGSALFEDQAIVAVNTFHNVMAGQPEELSNPNGNN----------QIFMNQRG
3cc1B           GRNGEAYVA--LFNLHDQQKTLQFRLDVGIETVQLFNVWDRSFLQSLAPSESFQIELKPHQSLKLS----
1a0dA           ----------------------------------------------------------------------
3clwC           WWTAVSLGEDVPIQLLPLEGSNGLSLQYDGEISTTKMLWTTANAIKPTYKISDLEAATSLMISSYTDGK-
2bfgA           SIPKPTFHAFTF--FNALGDELLYRDGEMIVTRRKDGSIAAVLWNLVMEKGEGLTKEVQLVIPVSESAVF
3cttA           ELCRRWMQLAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHDTVARPLLHEFYEDNSTWDVHQQFLWG
2bs9A           HS-IPKPTFHAFTFFNALGDELLYRDGEMIVTRRKDGSIAAVLWNLVMEKGEGLTKEVQLVIPVSESAVF
1bagA           VRFPGKSQIGDRGSAL------FEDQAITAVNRFHNVM-------AGQPEELSNPNGNNQIFMNQRGSHG
1bplB           SQREIPALK-------------HKIEPILKARKQYAYGAQHDY---------FDHHDIVGWTREGDSSVA
2c7fA           AQLINVIAPIVTE-RNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIEVAIYNEEK
3b40A           WADSSRPLPFFNDSPDALGGLSPLGKQAVERLNDLGVIIDVSQMSTKALEQVAALSRAPIVASHSAPRAL
3cc1A           WTLSLLTNE-----------------GILSINQKSVLNRFVYREEDKVAWAANGRNGEAYVALFNLHDQQ
2droA           ----------------------------------------------------------------------
1cbyA           TVEISVMVE---QLKKIIQEVLGLVINSTSFWNSVEATIKGTFTQIDEAWIFWHSLSAHNILFSIQNEDT
1bglA           DNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAW
3czjA           HSDNELLHWM-VALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHI
1b5tB           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
3a5vA           TTKEIIMNKEV------------IAVNQDSSFSPANRIWVKGDQ---QLFSGNLANNTQVVILLNAGD--
1cz1A           WKTENAPEW-------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
1bxcA           LLAAYYQEDPAALPL-------------------------------------------------------
1eceA           DSGDTGGIL-KDDWQTVDTVKDGYLAPIKSSIFD------------------------------------
1b5tA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2cwtA           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
2e3zB           WNYLWKAYDKPVYVTENGFPVKGENDLPVEQAVDDTDRQAYYRDYTE-----------------------
3bc9A           ----------------------------------------------------------------------
3dymA           DNELLHWMV-ALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISA
1cbgA           LGPMAASSWLCIYPQGIRKLLLYVKNHYNNPVIYITRNEFNDPTLSLQESLLDTPRIDYYYRHLYYVLTA
1ac0A           ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1cqyA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2e3zA           WLLNYLWKAYDKPVYVTENGFPVKGENDLPVEQAVDDTDRQAYYRDYTEALL------------------
3cozB           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           LKNPEVIAVDQDSRGLQGVKVAEDTTGLQAYGKVLSGTGNRAVVLLNRTSAAHDI---------------
2c3wA           ----------------------------------------------------------------------
1e4mM           STDNIYYYPK------------------------------------------------------------
2dkdB           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           ----------------------------------------------------------------------
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           ----------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           GVKVAEDTTGLQAYGKVLSGTGNRAVVLLNRTSAAHDITVRWSDLGLTNA--------------------
2cncA           WLND------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
2d0fA           -NRIAVVLNNDSVNVPVWQLSMPNGSTVTDKITGHSYTVQNGM---------------------------
1bvzA           -QHVGVVLNNRGKQTVLLQVPESGGKTWLDCLTGEEVHGKQGQ--------------------LKLTLRP
3edeA           -KRIMVAMNNND-----KPMTLP-TARFQEMLKGAPSGVDFL-------------SGKTVGLGRELRLAP
2bhuA           -GERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTLG---------------------------
3edfA           -KRIMVAMNNND-----KPMTLP-TARFQEMLKGAPSGVDFL-------------SGKTVGLGRELRLAP
3ecqB           GKKLSTDKEKYYFNTQAGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYR
1ehaA           RKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYE---FD
2bhyA           -GERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTLG---------------------------
2bhzA           -GERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTLG---------------------------
2e8yA           WKDIIVIHHASP---DSVEWRLPNDIPYRLLCDPSGFQEDPTE---------------------------
1eh9A           RKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYE---FD
1cgtA           VAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGV-----------------------------------
1cguA           VAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVL----------------------------------
6cgtA           VAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGV-----------------------------------
1cgxA           ----------------------------------------------------------------------
3ecqA           ATTWTLPSDWAKSKVYLYK---------------------------------------------------
3eddA           DKRIMVAMNNND-----KPMTLP-TARFQEMLKGAPSGVDFL-------------SGKTVGLGRELRLAP
1bvnP           --GFIVFNNDDWQLSSTLQTGLP-GGTYCNVISGDKVGNSCTGI--------------------------
1dhkA           --GFIVFNNDDWQLSSTLQTGLP-GGTYCDVISGDKVGNSCTGIKV------------------------
2dieA           NSGLATIMSDGPGGNKWMYVGKHKGQVWRDITGNRSGTVTINA---------------------------
3cgtA           VAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVL----------------------------------
3bmvA           NLSTSYNITGLYTALPAGT---------------------------------------------------
3czeA           ----------------------------------------------------------------------
3bh4A           ------ITDGPGGSKRMYAGLKNAGETWYDITGNRSDTVKIGSDGWGE----------------------
1cygA           SSSSNYSITGLFTALPAGTYTDQLGGLLDGNTI-------------------------------------
3czkA           ----------------------------------------------------------------------
3czgA           ----------------------------------------------------------------------
1e3xA           NSGLAALITDGPGGAKRMYVGRQNGETWHDITGNRSEPVVINS---------------------------
1cgvA           ----------------------------------------------------------------------
2d73A           ANGGGYAISIKEVKDKSEAKGLKR----------------------------------------------
1cgwA           ----------------------------------------------------------------------
1b0iA           ----MAINKEDSTLTATVQTDMA-SGQYCNVLKGELSADAKSC--------SGEVITVNSDGTINLNIGA
3czlA           ----------------------------------------------------------------------
1ea9C           QDTILVVMNNDKAG-HTLTLPVR-HAQWTHLWQDDVLTAAHGQLTVKLPAYGFA----------------
1a47A           NLSTSYNITGLYTALPAGT---------------------------------------------------
1c7tA           QALEKDWLRF------ANILGQRELAKLDKGGVAYRLPVPGARVAGGKLEANIALPGLGIEYSTDGGKQW
1bliA           --GLAALITDGPGGAKRMYVGRQAGETWHDITGNRSEPVVINS---------------------------
4cgtA           VAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGV-----------------------------------
1dtuA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1bf2A           SNSIYVAYNGWSSSVTFTLPAPPSGTQWYRVTDTCDWNDGASTFVAPGSET------LIGGAGTTYGQCG
1d3cA           ----------------------------------------------------------------------
3bakA           GNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKI------------------------
2cpuA           --GFIVFNNDDWSFSLTLQTGLPA-GTYCDVISGDKINGNCTGIKI------------------------
1aqmA           ----MAINKEDSTLTATVQTDMA-SGQYCNVLKGELSADAKSC--------SGEVITVNSDGTINLNIGA
1avaA           ----------------------------------------------------------------------
2aaaA           GSQVITVLSNKGSSGSSYTLTLSGSGKLIEAYTCTSVTVDSSGDIPVP----------------------
1d7fA           NTPASITGLVTSLPRGSYN---------------------------------------------------
3dhuA           -EALTAWIPLKGQV-TAVATKLA-AGSYQNLLTDGPTEVVDGK---------------------------
2c7fD           EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEPKNSDKSSFDDGILTSMLRR
3dhpA           GNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI--------------------------
2dh3B           -ERFLVVLNFGD---VGLSAGLQASDLPASA------SLPAKADLLLSTQPGREEGSPLELERLK--LEP
3dhuB           GEALTAWIPLKGQV-TAVATKLA-AGSYQNLLTDGPTEVVD-GKLTVD----------------------
1c7sA           LEKDWLRFANILGLAKLDKGGVAYRLPVPGARVAGGKLEANIALPGLGIEYSTDGGKQWQRYDAKAKPAV
2c8nD           EEVTIFAVNRNIHEDIVLVSDVRKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGITSMLRR
3blpX           GNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI--------------------------
2c7fF           EEVTIFAVNRNIHEDIVLVSDVRGMKRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSFDDGILTSMLRR
2dh2A           -ERFLVVLNFGD---VGLSAGLQASDLPASA------SLPAKADLLLSTQPGREEGSP--LELERLKLEP
3blkA           GNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI--------------------------
2c8nF           EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSSFDDGILTSMLRR
2c8nE           EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFILTSMLRR
2dh3A           -ERFLVVLNFGD---VGLSAGLQASDLPASA------SLPAKADLLLSTQPGREEGSPLELERLK--LEP
1amg-           ----------------------------------------------------------------------
2c8nB           EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDIRNSVNGEEVYPKNSDKSSFDDGILSMLRR
2c8nA           --VTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKKSSFDDGILTSMLRR
2c7fB           EEVTIFAVNRNIHEDIVLVSDVRGMRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRR
3clwA           --EVVTVAINYSKENQVISLNCDHAQKGKVYLTTIDKNLRYMGE----------------QPLKKLQLPA
3cnyA           ----------------------------------------------------------------------
2choA           VEITPWVHQFKLTAEMGEEVLKMVEGRNESYF--------------------------------------
2c7fE           EEVTIFAVNRNIHEDIVLVSDV--RGRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSS---ILTSMLRR
2choB           RNESYFLRKYNHVKALQQQMFYIDQTSNQNPYQPG-----------------------------------
3bsgA           ----------------------------------------------------------------------
2c7fC           EEVTIFAVNRNIHEDIVLVSDVRGMRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRR
3bshA           ----------------------------------------------------------------------
3dc0A           SKGVVLANAGSSSVSINASTKLPD-GSYDNKAGTGSFQVRDGKLTG------------------------
3cc1B           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
3clwC           --EVVTVAINYSKENQVISLNCDHAQKGKVYLTTIDKNLRYMGE----------------QPLKKLQLPA
2bfgA           IKRQIVNEQYGNAWRVWKQMG------RPRFPSRQAVETLRQVAQPHVMTEQRRATDGVIHLSIVLSKNE
3cttA           PGLLITPVLDEGAEKVMAYV---PDAVWYDYETGSQVRWRKQKVEMELPGDKIG----------------
2bs9A           IKRQIVNEQYGN----------------------------------------------------------
1bagA           V---VLANAGSSSVSINTATKLPD-GRYDNKAGAGSFQVNDGKL--------------------------
1bplB           NSGLAALITDGPGGAKRMYVGRQNGETWHDITGNRSEPVVINS---------------------------
2c7fA           EEVTIFAVNRNIHEDIVLVSDVRGMRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKFDD--GILTSMLRR
3b40A           VDIKRNLSDHEMQLIKDSGGVIQVVGFPAYLRPLSKPTLDKL----------------------------
3cc1A           KTLQFRLDVGIEVQLFNVWDRSFLQS--------------------------------------------
2droA           ----------------------------------------------------------------------
1cbyA           GAVMAVLPLAFE---VSVDVEKQK-VLFFTIKDSARYEVKMKA---------------------------
1bglA           QQWRLAENLSVTLPAASHA---------------------------------------------------
3czjA           SAWQQWRLAENLSVTLPAA---------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
3a5vA           -SAAKMTATWDDIWVYNLP--NVDSSRSIEVRDLWK-----------------QKSLGNFSNHITLDVPA
1cz1A           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2cwtA           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2ckrA           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
2e3zB           ----------------------------------------------------------------------
3bc9A           ----------------------------------------------------------------------
3dymA           WQQWRLAENLSVTLPAASH---------------------------------------------------
1cbgA           IGDGVNVKGYFAWSLFDN----------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1cqyA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2e3zA           ----------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2eiyB           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
2c3wA           ----------------------------------------------------------------------
1e4mM           ----------------------------------------------------------------------
2dkdB           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
2cksA           ----------------------------------------------------------------------
1de5A           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
2ej0F           ----------------------------------------------------------------------
3cejA           ----------------------------------------------------------------------
2c3wD           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           MATLVLKLIK
2d0fA           ----------
1bvzA           YQGMILWNGR
3edeA           KSVVVIEL--
2bhuA           ----------
3edfA           KSVVVIEL--
3ecqB           S---------
1ehaA           KGFALYK---
2bhyA           ----------
2bhzA           ----------
2e8yA           ----------
1eh9A           KGFALYK---
1cgtA           ----------
1cguA           ----------
6cgtA           ----------
1cgxA           ----------
3ecqA           ----------
3eddA           KSVVVIEL--
1bvnP           ----------
1dhkA           ----------
2dieA           ----------
3cgtA           ----------
3bmvA           ----------
3czeA           ----------
3bh4A           ----------
1cygA           ----------
3czkA           ----------
3czgA           ----------
1e3xA           ----------
1cgvA           ----------
2d73A           ----------
1cgwA           ----------
1b0iA           WDAMAIHKNA
3czlA           ----------
1ea9C           ----------
1a47A           ----------
1c7tA           QR--------
1bliA           ----------
4cgtA           ----------
1dtuA           ----------
1cxlA           ----------
1cgyA           ----------
1cdgA           ----------
1bf2A           QSLLLLIS--
1d3cA           ----------
3bakA           ----------
2cpuA           ----------
1aqmA           WDAMAIHK--
1avaA           ----------
2aaaA           ----------
1d7fA           ----------
3dhuA           ----------
2c7fD           ASWNVIRI--
3dhpA           ----------
2dh3B           HEGLLLRF--
3dhuB           ----------
1c7sA           SGEVQVRSV-
2c8nD           ASWNVIRI--
3blpX           ----------
2c7fF           ASWNVIRI--
2dh2A           HEGLLLRF--
3blkA           ----------
2c8nF           ASWNVIRI--
2c8nE           ASWNVIRI--
2dh3A           HEGLLLRFPY
1amg-           ----------
2c8nB           ASWNVIRI--
2c8nA           ASWNVIRI--
2c7fB           ASWNVIRI--
3clwA           RSVATIVV--
3cnyA           ----------
2choA           ----------
2c7fE           ASWNVIRI--
2choB           ----------
3bsgA           ----------
2c7fC           ASWNVIRI--
3bshA           ----------
3dc0A           ----------
3cc1B           ----------
1a0dA           ----------
3clwC           RSVATIVV--
2bfgA           VTLIEIE---
3cttA           ----------
2bs9A           ----------
1bagA           ----------
1bplB           ----------
2c7fA           ASWNVIRI--
3b40A           ----------
3cc1A           ----------
2droA           ----------
1cbyA           ----------
1bglA           ----------
3czjA           ----------
1b5tB           ----------
3bobA           ----------
2aamC           ----------
2aamA           ----------
3a5vA           HGVRLLKF--
1cz1A           ----------
2c0hA           ----------
1bxcA           ----------
1eceA           ----------
1b5tA           ----------
2aamB           ----------
1chkA           ----------
2agaA           ----------
3civA           ----------
1bplA           ----------
2cwtA           ----------
2cleA           ----------
2ckrA           ----------
1a5sA           ----------
3coyA           ----------
2e3zB           ----------
3bc9A           ----------
3dymA           ----------
1cbgA           ----------
1ac0A           ----------
1bqcA           ----------
1cqyA           ----------
1a5bA           ----------
2e3zA           ----------
3cozB           ----------
2cliA           ----------
3c0uA           ----------
2eiyB           ----------
3a21A           ----------
2c3wA           ----------
1e4mM           ----------
2dkdB           ----------
3cepA           ----------
1b31A           ----------
2a6tA           ----------
2diwA           ----------
2cksA           ----------
1de5A           ----------
1bksA           ----------
2ej0F           ----------
3cejA           ----------
2c3wD           ----------
3a21B           ----------
2cncA           ----------