[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30613.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bh1A.bssp"
#ERROR : Can't open dsspfile "2droA.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "3bw2A.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "3bm5B.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "1ea0A.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "2c6qG.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "2bznC.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "2a4aB.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"

## Summary of PDB Search
:528
    5e-17  11%  2bh1A  [x.x.x] GENERAL SECRETION PATHWAY PROTEIN L
    4e-16  10%  2droA  [x.x.x] XYLANASE Y
    8e-13   9%  2bwgB  [x.x.x] GMP REDUCTASE I
    4e-12  13%  2e77C  [x.x.x] LACTATE OXIDASE
    7e-12  11%  2bleA  [x.x.x] GMP REDUCTASE I
    1e-11  14%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    1e-11  10%  2e77B  [x.x.x] LACTATE OXIDASE
    2e-11  15%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    4e-11  15%  3bw2A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    1e-10  15%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    4e-10  10%  2bwgA  [x.x.x] GMP REDUCTASE I
    5e-10   9%  3bm5B  [x.x.x] CYSTEINE SYNTHASE
    7e-10  11%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    7e-10  11%  2a1yA  [x.x.x] GMP REDUCTASE
    9e-10  11%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    1e-09   9%  2bwgD  [x.x.x] GMP REDUCTASE I
    1e-09  12%  2e77A  [x.x.x] LACTATE OXIDASE
    1e-09  11%  2a7rB  [x.x.x] GMP REDUCTASE 2
    2e-09  11%  2bznB  [x.x.x] GMP REDUCTASE 2
    2e-09  24%  1ea0A  [d.153.1 - c.1.4 - b.80.4] GLUTAMATE SYNTHASE [NADPH] LARGE
    7e-09  10%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    1e-08  11%  2du2A  [x.x.x] LACTATE OXIDASE
    1e-08  10%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-08  11%  2a7rC  [x.x.x] GMP REDUCTASE 2
    6e-08  13%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    6e-08  12%  2bznD  [x.x.x] GMP REDUCTASE 2
    1e-07   8%  2c6qG  [x.x.x] GMP REDUCTASE 2
    1e-07  16%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    2e-07  11%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-07  10%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-07  11%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    4e-07  10%  2bznC  [x.x.x] GMP REDUCTASE 2
    5e-07  11%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    5e-07  13%  2c6qB  [x.x.x] GMP REDUCTASE 2
    7e-07   9%  2a4aB  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    8e-07  13%  2c6qA  [x.x.x] GMP REDUCTASE 2
    1e-06  12%  2a7rA  [x.x.x] GMP REDUCTASE 2
    1e-06  11%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-05  12%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    6e-05  11%  2bznA  [x.x.x] GMP REDUCTASE 2
    1e-04  14%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    3e-04  10%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
:528

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bh1A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2djxA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
2e68B           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxIQQYFIADNESEKPFGRELRSTIYRRAKGINDTVAFGTEKDIYRVGYEWVTHSLMPKHLDEIET
2bh1A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2e77C           -------------------------SKVVPHGGFNYIAGASEWTKRANDRAWKHKLLYPRLAQDVEAPDT
2bleA           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2e77B           ------------------------------------------------------KLLYPRLAQDVEAPDT
1b3oB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1d3gA           -----------------------------------------------------------------DSDML
2a1yA           ----------------------------------------------------------------------
1d3hA           -----------------------------------------------------------------DSDML
2bwgD           ----------------------------------------------------------------------
2e77A           -----------------------------------------------------------------EAPDT
2a7rB           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------MQLRDLLELRSTKAPVPV
2a4aA           ----------------------------------------------------------------------
2du2A           ------MNNNDIEYNAPSEIIDVVNTYDLEEEASKVVPHGGFNTKRANDRAWKHKLLYPRLAQDVEAPDT
2djxA           -------------------------------------------------------------------MCL
2a7rC           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ---------------------------------------------------------PRKSSVLPSEVSL
3c3nA           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1al8A           ------------------NEYEAIAKQKLPKMVYDYYASGAQWTLAENRNAFSRILFRPRILIDVTNIDM
2bznC           ----------------------------------------------------------------------
2djlA           -------------------------------------------------------------------MCL
2c6qB           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
2e68B           -------------------------------------------------------------------MCL
3c61A           -------------------------------------------------------------------MSL
2bznA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2b4gB           -------------------------------------------------------------------MSL


                         +         .         .         .         .         *         .:210
query           RVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
2bh1A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
2bwgB           ------------------------------------------------RTFTFRNSKQTYSGIPIIVANM
2e77C           STEILGHKIKAPFI-----MAPIAAHGLAHTTKEA----GTARAVSEFGTIMSISAYSGATFEISEGLNG
2bleA           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2e77B           STEILGHKIKAPFI-----MAPIAAHGLAHTTKAGTARAVEFGTIMSISAYSGATFEEISEGLNGGPRWF
1b3oB           ----------------------------------------------------------------------
3bw2A           -------------------QAPMAGGVSVPQLAAAV---CEAGGL-GFLAAGYKTADGMQEIKRLRGLTG
1eepB           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1d3gA           EVRVLGHKFRNPVG-----IAAGFDKHGEAVDGYKMGFGFVEIGSVTPKPQEGNPRPRVFDQAVINRYGF
2a1yA           ----------------------------------------------------------------------
1d3hA           EVRVLGHKFRNPVG-----IAAGFDKHGEAVDGYKMGFGFVEIGSVTPKPQEGNPRPRVEDQAVINRYGF
2bwgD           ----------------------------------------------------------------------
2e77A           STEILGHKIKAPFI-----MAPIAAHGLAHTTKEA----GTARAVSEFGTIMSISAYSGATFEEISEGLN
2a7rB           ----------------------------------------------------------------------
2bznB           -----------------------------------------------------------------PIIAA
1ea0A           DEVESITAIRKRFI-----TPGMSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKNGDNWNS
2a4aA           ----------------------------------------------------------------------
2du2A           STEILGHKIKAPFI-----MAPIAAHGLAHTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRW
2djxA           KLNLLDHVFANPFM-----NAAGVLCCTEEDLRCMTASSS---GALVSKSCTSAP-----------RDGN
2a7rC           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznD           -----------------------------------------------------------------PIIAA
2c6qG           ----------------------------------------------------------------------
1eepA           KTQL----TKNISLNIPFLSSAMDTVTESQMAIAIAK-------------EGGIGIIHKNMSIEAQRKEI
3c3nA           KLNLLDHVFANPFM-----NAAGVLCSTEEDLRCMTASSS-GALVSKSCTSAPRDGNPEPRYMAVPLGSI
1ak5A           ----------------------------------------------------------------------
1al8A           TTTILGFKISMPIM-----IAPTAMQKMAHPEGEYATARAA-----SAAGTIMTLSSWATSSVEEVASTG
2bznC           -----------------------------------------------------------------PIIAA
2djlA           KLNLLDHVFANPFM-----NAAGVLCCTEEDLRCMTASSSGALVSKSCTSAP--------------RDGN
2c6qB           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
2e68B           KLNLLDHVFANPFM-----NAAGVLCSTEEDLRCMTASSSGALVSKSCTSAP--------------RDGN
3c61A           QVDLLNNTFANPFM-----NAAGVMCSTTEDLVAMTESASGSLVSKSCTPALREGNPTPRYRALPLGS-I
2bznA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2b4gB           KVNILGHEFSNPFM-----NAAGVLCTTEEDLRRMTESESGSLIGKSCTLAPRTGNPEPRYLGSINSMGL


                         .         .         .         +         .         .         .:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
2bh1A           ----------------------------------------------------------------------
2droA           --------------------------LLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFS----------
2bwgB           DTVGTFEMAAVMSQHSMAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFIC
2e77C           GPRW-------------FQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKN-KFVYPFG
2bleA           --------------------KHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFIC
2cu0B           ----------------------EQVKRVKRAKYKNAVRDENGELLVAAAVSPFDIKRAIELDKAGVDVIV
2e77B           QIYMAKDDQQNRDILDEAKSDGAT----AIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGM
1b3oB           ------------DDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVV
3bw2A           RPFG-------------VNVFMPQPELGAVEVYAHQLAGEAAWYETELG-DPDGGRDDGYDAKLAVLLDD
1eepB           -----------------KTYDFPNACKDLNNKLRVGAAVSID-----IDTIERVEELVKAHVDILVIDSA
2bwgA           -----------------AIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFIC
3bm5B           --------------------------------------------SPRKRIYHNILETIGGTPLVELHGVT
1d3gA           NSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTA
2a1yA           -----------------------------------------ASISVGVKEDEYEFVQQLAAEHLTPEYIT
1d3hA           NSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTA
2bwgD           -----------------------------ATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLD
2e77A           GGPRWFQIYMAKDDQQNRDIL-------------DEAKSDGATAIILTADSTNRDRDVKNKFVYPFGMPI
2a7rB           -----------------------------FAGQNPDCLEHLAASSGTGSSDFEQLE-QILEAIPQVKYIC
2bznB           NMDTVGTFEMAKVLCKFAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
1ea0A           AIQVASGRFG-------VTAEYLNQCRELEIKVAQGAKPGEGGQLPGFKVTEMIARLRHSTPGVMLISPP
2a4aA           --------------------------NPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINY
2du2A           --FQIYMAKDDQQNRDILDEAKSDGATAIIL---TADSTVSGNRDRDVKNKFVYPMPIVQRYLRGTAEGM
2djxA           PEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVL
2a7rC           -----------VHKHYSLVQWQEFAGQNPDCLEHLAA------SSGTGSSDFEQLE-QILEAIPQVKYIC
2cu0A           ----------------------EQVKRVKRAEKYKNAVRDENGELLVAAAVSPFDIKRAIELDKAGVDVI
2bznD           NMDTVGTFEMAKVLCKFAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
2c6qG           ---------------------------MAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGT
1eepA           EKVKTYKDFP-------------NACKDLNNKLRVGAAVSIDIDTIERVE-------ELVKAHVDILVID
3c3nA           NSMGLPNLGFDFYLK-YASDLHDYSKKPLFLSIS-GLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVP
1ak5A           ---------------------------------------------------------------VDSQKRY
1al8A           PGIRFFQLYVYKDRNVVAQRAERAGFKAIALTVDTPRLIKNFVLPPFLTLKNFEGIDLGLSSYVAGQIDR
2bznC           NMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQV
2djlA           PEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVP
2c6qB           ----MAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLE-QILEAIPQVKYIC
2a4aB           ----------------FINEKIKQEINPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINY
2c6qA           ---------------------------QEFAGQNPDCLEHLAASSGTGSSDFEQLE-QILEAIPQVKYIC
2a7rA           ----------------------------------------------------------------------
2e68B           PEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVL
3c61A           NSMGLPNNGFDFYLA-YAAEQHDYGRKPLFLSMS-GLSVRENVEMCKRLAAVATEKGVILELNLSCPNVP
2bznA           ----MAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLE-QILEAIPQVKYIC
1b3oA           ----------------------NEVRKVKDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVV
2b4gB           PNLGVDFY------LSYAAQTHDYSRKPLFLSM-SGLSVEESVEMVKKLVPITKEKGTILELNLSCPNVP


                         .         *         .         .         .         .         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVXXXXXXXXXXPL
2bh1A           ----------------------------------------------------------------------
2droA           -DPSYHLPHFYELFSLWANE----EDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGH
2bwgB           LDVANGYSEHFVEFVKLVRAKFPE-HTIMAGNVVTGEMVEELILS------GADIIKVGVGPGSVCTTRT
2e77C           MIYGASKQKISPRDIEEIAG-HSGLPVFVKGIQH-----PEDADMAIKRGA--SGIWVSNHGA-------
2bleA           LDVANGYSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILS------GADIIKVGVGPGSVCTTRT
2cu0B           VDTAHAHNLKAIKSMKEMRQKVD-ADFIVGNIANPKAVDDLTFADAVKVGIGPGSICTT-----------
2e77B           SLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPE---DADMAIKRGA--SGIWVSNH---------
1b3oB           LDSSQGNSIFQINMIKYIKDKYPNLQVIGG-----NVVTAAQAKNLIDAGV--DALRVGMGSGSICITQ-
3bw2A           PVPVVSFHFGVPEVIARLRR-AGTLTLVTA----TTPE-----EARAVEAAGADAVIAQGVEAGGHQGTH
1eepB           HGH----STRIIELIKKIKTKYPNLDLIAGNIVT-----KEAALDLISVGA--DCLKVGIGPGSICT--T
2bwgA           LDVANGYSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILS------GADIIKVGVGPGSVCTTRT
3bm5B           EHPRIKKGTRILVKLEYFNPMSSVKDRV---------GFNIVYQAIKDGRLKPGMEIIESTSGNTGIALC
1d3gA           GLGKAELRRLLTKVLQERDGLRRVHRPAVKIAPDTSQDKEDIASVVKELGI--DGLIVTNTTVSRPAGLQ
2a1yA           IDIAHGHSNAVINMIQHIKKHL-PESFVIAGNVGTPEAVRELENAG------ADATKVGIGPGKVCITKI
1d3hA           GLAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKDIASVVKELGI--DGLIVTNTTVSRPAGLQ
2bwgD           VANGYSEHFV--EFVKLVRAK-FPEHTIMAGNVVTGEMVEELILSG------ADIIKVGVGPGSVCTTRT
2e77A           VQNNIYGASKQKISPRDIEEIAGGLPVFVK-GIQHPEDADMAIKRGA------SGIWVS---------NH
2a7rB           LDVANGYSEHFVEFVKDVRKRF-PQHTIMAGNVVTGEMVEEL--------ILSGADIIKVGIGPGSVCTT
2bznB           LDVANGYSEHFVEFVKDVRKRF-PQHTIMAGNVVTGEMVEELILSG------ADIIKVGIGPGSVCTTRK
1ea0A           PHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAAGVAK------------------------
2a4aA           KKIIENTDEGLKEATKLTQSVLTNKILKVIIEVGTEDLIIKTTLAVLNGNA--DFIKTS---------TG
2du2A           SLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPE---DADMAIKRGASGIWVSNHGA---------
2djxA           LELNLSCPNVPGKPQVAYQQVSLAYGLPFGVKMFDIAHFDTAAAVLNEFPL--VKFVTCVNSVGNGLVID
2a7rC           LDVANGYSEHFVEFVKDVRKRF-PQHTIMAGNVVTGEMVEELILS--------GADIIKVGIGPGSVCTT
2cu0A           VDTAHAHNLKAIKSMKEMRQKV-DADFIVGNIANPKAVDDLTFADAVKVGIGP-----------GSICTT
2bznD           LDVANGYSEHFVEFVKDVRKRFPQHTI-MAGNVVTGEMVEELILSG------ADIIKVGIGPGSVCTTRK
2c6qG           GSS---DFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKAGNVVTGEMVEEILSGADIIKVGIG
1eepA           S--AHGHSTRIIELIKKIKTKYPNLDLIAGNIVT-KEAALDLISVG------ADCLKVGIGPGSICTTRI
3c3nA           GKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYDIAHFDTAAAVLNEFPL--VKFVTCVNSVGNGLVID
1ak5A           LVGAGINTRDFRERVPALVE-AGADVLCIDSSDGFSEWQKITIGWIREKYGDKVKVGAGNIVDGEGFRYL
1al8A           SLS--------------WKDVAWLQTITSLPILVKGVITAEDARLAVQHGA--AGIIVS---------NH
2bznC           KDVANGYSEHFVEFVKDVRKRFPQHTI-MAGNVVTGEMVEELILSG------ADIIKVGIGPGSVCTTRK
2djlA           GKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAFDTAAAVLNEFPL--VKFVTCVNSVGNGLVID
2c6qB           LDVANGYSEHFVEFVKDVRKRF-PQHTIMAGNVVTGEMVEELILS--------GADIIKVGIGPGSVCTT
2a4aB           KKIIEEGLKEATKLTQSVKKLLTNKILKVIIEVGTEDLIIKTTLAVLNGNA--DFIKTSTG---------
2c6qA           LDVANGYSEHFVEFVKDVRKRF-PQHTIMAGNVVTGEMVEELILSG------ADIIKVGIGPGSVCTTRK
2a7rA           ----------------------------------------------------------------------
2e68B           LELNLSCPNVPGKPQVAYDFEAMRTYLQQYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESES
3c61A           GKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPQVQFITCI-----------
2bznA           LDVANGYSEHFVEFVKDVRKRFPQHTI-MAGNVVTGEMVEELILS--------GADIIKVGIGPGSVCTT
1b3oA           LDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVT-----AAQAKNLIDAGV--DAL--------------
2b4gB           GKPQVGYDFDTTRTYLQKVSEAYGLPFGVKMPPYDIAHFDMAAAVLNDFPL--VKFITCVNSIGNGLVID


                         .         .         .         .         *         .         .:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
2bh1A           ----EADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVV--VLLAAS----------------D
2droA           FFSCSYRVAANIGLDAEGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEKSLHPVGLIATNAMGSL
2bwgB           KTGVGYPQLSA------VIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGE
2e77C           --RQLYEAPGSFDTLPAIA----ERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLAL---
2bleA           KTGVGYPQLSAVIECADSAH------GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAG-
2cu0B           RIVAGVGVPQITAVAMVADRAQEYG----LYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGK
2e77B           GARQLYEAPGSFDTL----PAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALG--
1b3oB           -EVLACGRPQATAVYKVSEYARRFG----VPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGE
3bw2A           RDSSEDDGAGIGLLSLLAQ------VREAIPVVAAGGIMRGGQIAAVLAAGADAAQLGTAFLATDES---
1eepB           RIVAGVGVPQITAICDVYEACNNTN----ICIIADGGIRFSGDVVKAIAAGADSVMIGNLF---------
2bwgA           KTGVGYPQLSA------VIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMHTECAGEVIE
3bm5B           QAGAVFGYRVNIAMPSTMSVERQMIMKAFGAELILTEGKKGMPIEEVNKMIKENPG---------KYFVA
1d3gA           GALRSESGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVG
2a1yA           KTGFGTGGWQLAALRWCAKAA-------SKPIIADGGIRTNGDVAKSIRFGATMVMIGSLFAGHEESPGE
1d3hA           GALRSLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFW------
2bwgD           KTGVGYPQLSA------VIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECA-G
2e77A           GARQLYEAPGSFDTLPAIAERV----NKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLAL---
2a7rB           RKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2bznB           KTGVGYPQLSA--VMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
1ea0A           ----------------------------------------------------------------------
2a4aA           KVQINATPSSVEYIIKAIKEYIKNEKNNKIGLKVSGGISDLNTASHYILLARRFLSDNFRIGSSSLVIKL
2du2A           --RQLYEAPGSFDTLPAIAERV----NKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLAL---
2djxA           AESESVVIKPKQGFGGLGGKYILPTACPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2a7rC           RKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2cu0A           RIVAGVGVPQITAVAMVADRAQEYG----LYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGK
2bznD           --KTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2c6qG           PGSVCTTRKKTGVGYPQLSAVMECAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESLIE
1eepA           VAGVGVPQITA--ICDVYEACNNTN----ICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSE
3c3nA           AESESVVIKPKQGFGGLGGKYILPTACPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
1ak5A           AIGIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESPTR
1al8A           GARQLDYVPATIMALEEVVKAA----QGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAA---
2bznC           KTGVGYPQLSAVMECADAAH------GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2djlA           AESESVVIKPKQGFGGLGGKYILPTACPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2c6qB           RKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2a4aB           KVQINATPSSVEYIIKAIKEYIKNEKNNKIGLKVSGGISDLNTASHYILLARFLFRIGSSSLVIKLR---
2c6qA           --KTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2a7rA           -------------------------HGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2e68B           GFGGLGGKYILPTALANVNAFYRRC--PDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
3c61A           NSIGNGLVIDAETESVVIKPKQGFGGCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFE
2bznA           RKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
1b3oA           ----RVGMGSRPQATAVYKVSEYAR-RFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGE
2b4gB           PANETVVIKPKQGFGGLGGKYVLPTALANVNVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFA


                         .         .         +         .         .         .         .:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEPENLKKRISVN
2bh1A           LILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFD
2droA           ASVDG-----PYAKANVDLFWNTPVRTG---NRRYYDNCLYLFAMLALSGNF------------------
2bwgB           KLKLFYGMSSDTAMNKHVAEYRASEGKTVEDVENTILDILGGLRSTCTYVGAAKLKELS-----------
2e77C           ----------------------------------------------------------------------
2bleA           EVIRKLKLFYGMSSDTAMNKHGVEVPYKG-DVENTILDILGGLRSTCTYVGAAKLKE-----LSRRATFI
2cu0B           EVIINGMGSLGAMMKYMKTRKFVPEGVEGVVVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVII---
2e77B           ----------------------------------------------------------------------
1b3oB           DKG-------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
1eepB           --AGTKESPSEEIIYNGKKFKSYGMVPYSGKLKDILTQLKGGLMSGMGYLGAATISDLKINSKFVKIS--
2bwgA           RNGRKLKLFYGMSSDTAMNKHGVAEGKTVEVVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVT--
3bm5B           NQFGNPDNTAAHHYTANEIWEDT-----------------------------------------------
1d3gA           KVKRELLKEQGFGGV-------------------------------------------------------
2a1yA           TIEKLYKEYFGSFVE---------HKGSLEDTLIEMEQDLQSSISYAGG---------------------
1d3hA           ----------------------------------------------------------------------
2bwgD           EVIRKLKLFYGMSSDTAMNKHAEYRASEGKTVEVPYKGDVENTISTCTYVGAAKLKELSRRATFIRVT--
2e77A           ----------------------------------------------------------------------
2a7rB           LDGKKYKLFYGMSSEMAMKKYAGGVAEYRSDVEHTIRDILGGIRSTCTYVGAAKLKELSR----------
2bznB           RDGKKYKLFYGMSSEMAMKKYASEGKTFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVT--
1ea0A           ----------------------------------------------------------------------
2a4aA           RKVIS-----------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2djxA           RLELEIMARKGYRTLEEFRGRVKTIE--------------------------------------------
2a7rC           LDGKKYKLFYGMSSEMAMKKYGKTVEVPFKDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVT--
2cu0A           EVIINGMGSLGAMMKYMKTRKFVPEGVEGVVVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVIIHPH
2bznD           LDGKKYKLFYGMSSEMAMKKYASEGKTFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV---
2c6qG           RDGKKYKLFYGMSSEMAMKKYSEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVKLKELSRRTTFIRVT--
1eepA           EIIYNGKKFKSMVPYSGKLKDIL-----------------------------------------------
3c3nA           RLE-------------------------------------------------------------------
1ak5A           INGSVMKEYWGEGSSRGVDSYVPYAG----KLKDNVEASLNKVKSTMCNCGALTIPQLQSKAKITLVSSV
1al8A           ----------------------------------------------------------------------
2bznC           LIERDYKLFYGMSSEMAMKKYASGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------
2djlA           RLE-------------------------------------------------------------------
2c6qB           LIERDGKKAGGVAEYRASEGKTVEVPFKG-DVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVT--
2a4aB           KVIS------------------------------------------------------------------
2c6qA           LIERDGKKAGGVAEYRASEGKTVEVPFKG-DVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV---
2a7rA           LDGKKYKLFYGMSSEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVT--
2e68B           RLEDEIMARKGYRTLEEFRGRVKTIE--------------------------------------------
3c61A           RLT-------------------------------------------------------------------
2bznA           LDGKKYKLFYGMSSEMAMKKYASGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------
1b3oA           DKG-------------------------------------------------------------------
2b4gB           RLN-------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EIKSYADLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bh1A           V-------------------------------------
2droA           --------------------------------------
2bwgB           --------------------------------------
2e77C           --------------------------------------
2bleA           RVTQ----------------------------------
2cu0B           --------------------------------------
2e77B           --------------------------------------
1b3oB           --------------------------------------
3bw2A           --------------------------------------
1eepB           --------------------------------------
2bwgA           --------------------------------------
3bm5B           --------------------------------------
1d3gA           --------------------------------------
2a1yA           --------------------------------------
1d3hA           --------------------------------------
2bwgD           --------------------------------------
2e77A           --------------------------------------
2a7rB           --------------------------------------
2bznB           --------------------------------------
1ea0A           --------------------------------------
2a4aA           --------------------------------------
2du2A           --------------------------------------
2djxA           --------------------------------------
2a7rC           --------------------------------------
2cu0A           DIIITNEA------------------------------
2bznD           --------------------------------------
2c6qG           --------------------------------------
1eepA           --------------------------------------
3c3nA           --------------------------------------
1ak5A           SI------------------------------------
1al8A           --------------------------------------
2bznC           --------------------------------------
2djlA           --------------------------------------
2c6qB           --------------------------------------
2a4aB           --------------------------------------
2c6qA           --------------------------------------
2a7rA           --------------------------------------
2e68B           --------------------------------------
3c61A           --------------------------------------
2bznA           --------------------------------------
1b3oA           --------------------------------------
2b4gB           --------------------------------------