[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30680.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c4iA.bssp"
#ERROR : Can't open dsspfile "3c4iB.bssp"
#ERROR : Can't open dsspfile "1b8zA.bssp"
#ERROR : Can't open dsspfile "2df8B.bssp"

## Summary of PDB Search
:90
    1e-21  34%  3c4iA  [x.x.x] DNA-BINDING PROTEIN HU HOMOLOG
    2e-21  34%  3c4iB  [x.x.x] DNA-BINDING PROTEIN HU HOMOLOG
    2e-16  36%  1b8zA  [a.55.1] PROTEIN (HISTONELIKE PROTEIN HU)
    6e-04  10%  2df8B  [x.x.x] 325AA LONG HYPOTHETICAL PROTEIN
:90

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSELVSAIAKEADVTKEVASNTLDATIAAVTKALKNGDSVTLVGFGTFQVKERSPREGRNPKTGETIK
3c4iA           MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVARNPRTGETVK
3c4iB           MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVARNPRTGETVK
1b8zA           MNKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEVVPK-FKPGKALKEKV---
2df8B           ---------TLIEIKQTPDGIIKADKVFNKVK-DKISLPNRILYLGCGS---------------------


                         .         .         *         .         .         .         .:140
query           IPASKVPSFKASKGLKDAVK
3c4iA           VKPTSVPAFRPGAQFKAVVS
3c4iB           VKPTSVPAFRPGAQFKAVVS
1b8zA           --------------------
2df8B           --------------------