[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30738.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "3c8vC.bssp"
#ERROR : Can't open dsspfile "3cgxA.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "3bbdA.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "2cu2A.bssp"
#ERROR : Can't open dsspfile "3duvB.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "3c8vA.bssp"
#ERROR : Can't open dsspfile "3c8vB.bssp"
#ERROR : Can't open dsspfile "3d5nA.bssp"
#ERROR : Can't open dsspfile "3d5nG.bssp"
#ERROR : Can't open dsspfile "3d5nB.bssp"
#ERROR : Can't open dsspfile "2dpwA.bssp"
#ERROR : Can't open dsspfile "3d5nH.bssp"
#ERROR : Can't open dsspfile "3d5nE.bssp"
#ERROR : Can't open dsspfile "3d5nI.bssp"
#ERROR : Can't open dsspfile "3ca8B.bssp"
#ERROR : Can't open dsspfile "3dk5A.bssp"
#ERROR : Can't open dsspfile "3ca8A.bssp"
#ERROR : Can't open dsspfile "3d5nF.bssp"
#ERROR : Can't open dsspfile "3c8vD.bssp"
#ERROR : Can't open dsspfile "2e8bA.bssp"
#ERROR : Can't open dsspfile "2ehoB.bssp"
#ERROR : Can't open dsspfile "3duvA.bssp"
#ERROR : Can't open dsspfile "3cbtA.bssp"
#ERROR : Can't open dsspfile "3eg4A.bssp"

## Summary of PDB Search
:287
    3e-83  49%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-55  47%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-47  47%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-46  47%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-36  19%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    6e-36   7%  3c8vC  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    4e-34  12%  3cgxA  [x.x.x] PUTATIVE NUCLEOTIDE-DIPHOSPHO-SUGAR TRANSFERASE
    3e-33  19%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-30   7%  3bbdA  [x.x.x] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE
    5e-30  19%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-26  16%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    6e-26  16%  2cu2A  [x.x.x] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL
    3e-24  13%  3duvB  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    5e-24  11%  1e5kA  [c.68.1] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-22  11%  3c8vA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    3e-22   9%  3c8vB  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    8e-22  15%  3d5nA  [x.x.x] Q97W15_SULSO
    7e-21   9%  3d5nG  [x.x.x] Q97W15_SULSO
    2e-20  13%  3d5nB  [x.x.x] Q97W15_SULSO
    4e-20  11%  2dpwA  [x.x.x] HYPOTHETICAL PROTEIN TTHA0179
    8e-20  13%  3d5nH  [x.x.x] Q97W15_SULSO
    8e-20   9%  3d5nE  [x.x.x] Q97W15_SULSO
    6e-19   8%  3d5nI  [x.x.x] Q97W15_SULSO
    2e-18   7%  3ca8B  [x.x.x] PROTEIN YDCF
    2e-18  24%  3dk5A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    6e-18   9%  3ca8A  [x.x.x] PROTEIN YDCF
    6e-17  12%  3d5nF  [x.x.x] Q97W15_SULSO
    7e-17   9%  3c8vD  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    9e-16  17%  2e8bA  [x.x.x] PROBABLE MOLYBDOPTERIN-GUANINE DINUCLEOTIDE
    2e-14  10%  2ehoB  [x.x.x] DNA REPLICATION COMPLEX GINS PROTEIN PSF1
    2e-09  13%  3duvA  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    1e-04   9%  3cbtA  [x.x.x] PHOSPHATASE SC4828
    2e-04   9%  3eg4A  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2,6-DICARBOXYLATE N-
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
2e3dC           TKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dD           -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dB           TKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dA           TKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
3d8vA           GDT-AVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGEL
3c8vC           -------------GTQLELLLERIDRVNVNLHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFK
3cgxA           --LFFVKYPEPGKKTRLGEV----VGNDKAALYRHFVQDLQGLARLHADLHICYVPGDADLPEKFKAWLG
3dj4A           ----AVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGEL
3bbdA           ----------------------------------------------------------------------
3d98A           FPGDAVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGEL
3brkX           LARDAAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNANSGIRRIGVATQYKAHSLIRHLQRG
2cu2A           MKT-YALVMAGGRGERLWPLSRERPKPFLPLFEKTLLEATLERLAPLVPPERTLLAVRRDQEAVARPYAD
3duvB           -----VIIPARFASSRLPG------KPLADIKGKPIQHV-FEKALQSGASRVIIAT---------DNENV
1e5kA           MTTITGVVLAGGKARRMGG----VDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLK--
3c8vA           --------------------------------------TQLELLLERIIDRVNVNLRHQKFDVGDYVRRQ
3c8vB           --------------------------------------TQLELLLERIIDRVNVNLRHQKFDVGDYVRRQ
3d5nA           ----GVIILAAGEGKRFGG-----DKLLAKIDNTPIIRT----IRIYGDLEKIIIVGKYVNELPLLDQIV
3d5nG           -------------------------KLLAKIDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQ--
3d5nB           ----GVIILAAG------------DKLLAKIDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQI-
2dpwA           ----SAIVLAGGKEAW-AERFGVGSKALVPYRGRPVEWVLE-ALYAAGLSPVYVGENPGLVPAPALTGLL
3d5nH           ----GVIILAAGEGDKLL----------AKIDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQI-
3d5nE           ----GVIILAAGEDKLLAK-----------IDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQIV
3d5nI           -----------------------AAKLLAKIDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQIV
3ca8B           PYQADCVILAGNAVMPTIDAAKIARDQQIPLLIHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQF
3dk5A           -----VLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGEL
3ca8A           ---ADCVILAGNAVMPTIDAACIARDQQIPLLIHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQF
3d5nF           ----GVIILAAG------------DKLLAKIDNTPIIRTI----RIYGDLEKIIIVGKYVNELPLLDQIV
3c8vD           --------------------------------------TQLELLLERIIDRVNVNLRHQKFDVGDYVRRQ
2e8bA           KVN-TCYVLAGGKSKRFGE-----DKLLYEIKGKKVIERVY-ETAKSVFKEVYIVAKDREKFSFLNAP--
2ehoB           ----------------------------------------------------------------------
3duvA           ------------------------------IPARKPIQHVFEKALQSGASRVIIATDN------------
3cbtA           ----------------------------------------------------------------------
3eg4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
2e3dC           FELEAMLE----RQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
2e3dD           FELEAML----KRQLLDEVQSICPPHVT--IMQVRQGKGLGHAVLCAHPVVGDEPVAVILPDVILDEYDL
2e3dB           FELEA---MLEKRQLLDEVQSICPPHVT--IMQVRQGKGLGHAVLCAHPVVGDEPVAVILPDVILDEYDL
2e3dA           FELEAMLERQLLDEVQSIC----PPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYDL
3d8vA           ADTL---------------------GRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTS-GDTPLL
3c8vC           NSSLAGSYLLGRVNVLHSALY--KSDIRGDELKRKGQHFVKIPLHDDEVITIKDSFLNKTLVHSNSHDPE
3cgxA           ----------------------------PQHFAAQQGLDLGERKHAQKAFDDGYDRVVLGSDIPDYPCE-
3dj4A           ADT---------------------LGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTS-GDTPLL
3bbdA           ---------------------------TYNIILAKSALELIPEEIKNKIRSRVYKYDILDSNYHYKAEK-
3d98A           ADTLG---------------------RTIDVALQDRPLGTGHAVLCGLSALPDDYAGNV----VVTSGDL
3brkX           WDFFRPE-----------------RNESFDILPASWYEGTADAVYQNIDIIEAPEYVILAGDHIYKDYE-
2cu2A           G---------------------IRLLLEPLGRDTAGAVLLGVAEALKE---GAERLLVLPADHYVGDDEA
3duvB           ADVAKSF-----------------GAEVCTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLIPPV-
1e5kA           ----------------------------VIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPD-
3c8vA           TPHLHYSKFYAFYGLSA--DDPVHFHFKNSSLAGSYLLGRVNVLHSA------LYKSDIRGDELKRKGQH
3c8vB           TPHL--------HYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELK---RK
3d5nA           ------------------------------IYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKE-
3d5nG           ----------------------------IVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKE-
3d5nB           -----------------------------VIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKED
2dpwA           ENLEQALEHVEGRVLVATGDIPHLTEEAVFVLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFT
3d5nH           -----------------------------VIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKE-
3d5nE           I------------------------------YNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKED
3d5nI           IY------------------------------NPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKE-
3ca8B           WHIP-----------------HEKIWIEDQSTNCGENA-RFSIALLNQAVERVHTAIVVQDPTMQRRTM-
3dk5A           AD---------------------TLGRTIDVALQDRPLGTGHAVLCGLSALP-DDYA---GNVVVTSGDL
3ca8A           WHI--------------PHEKIWIEDQST----NCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTM-
3d5nF           I------------------------------YNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKE-
3c8vD           TP--------------------HLHYSKFYAFYGLSADDPVHFHFKNSSLAGLLGRVNVLHSAL------
2e8bA           -------------------------VVLDEFEESASIIGLYTALKHAKE----ENVFVLSGDLPLMKKET
2ehoB           ----------------------------------------------------------------------
3duvA           ----------------ENVADVAKSFGAEVCTSVNHNSGTERLAEVVEKLAIPDNEII-----VNIQGDE
3cbtA           -----------------------------------------------------------APGSHILWRY-
3eg4A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
2e3dC           SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVDCKGVELVPMVGVVPKADVAPSNLAIVGRYVLS
2e3dD           SQDNLAEMIRRFDETGH-SQIMVEPV--ADVTAYGVVDCKGVE-LAPGESVPMVGVVPSNLAIVGRYVLS
2e3dB           SQDNLAEMIRRFDETGH-SQIMVEPV--ADVTAYGVVDCKGVELMVGVVEKPKADVAPSNLAIVGRYVLS
2e3dA           SQDNLAEMIRRFDETGH-SQIMVEPV--ADVTAYGVVDCKGVELMVGVVEKPKADVAPSNLAIVGRYVLS
3d8vA           DADTLADLIATHRAVSAAVTVLTTTL--DDPFGYGRILRTQDHEVMAIVEQTTPSQREIREVNAGVYAFD
3c8vC           SP----EEFTIRNTVAPYANIHGSLTEGSFIGSFATVDLTIHNSVVRYFSYVQTGELVGKCVEPGQIWIK
3cgxA           ---LVQKALNDLQHYD--AAIGPAFDGGYYLIGFRKDSFCPDVFDGIRWGEADVYQPTVEKRRARLEVLQ
3dj4A           DADTLADLIATHRAVSAAVTVLTTTL--DDPFGYGRILRTQDHEVMAIVEQTTPSQREIREVNAGVYAFD
3bbdA           ----LKDKERGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPE--TRLPRNYFRFLGVEKVL
3d98A           DADTLADLIATHRAVSAAVTVLTTTL--DDPFGYGRILRTQDHEVMAIVEQTDATPSEIREVNAGVYAFD
3brkX           ---YLQQHVDS------GADVTIGCLEVPREATGFGVHVNEKDEIIDFIEKPADP--PGIPGNEGFALAS
2cu2A           YREALATMLEAAEEGFV---VALGLRPTRPETEYGYPREGAWYRGEGFVEKPSYAEALEYIWNGGVFAFA
3duvB           ---IVRQVADNLAKFNVNASLAVKIHDAEELFNPNAVLTDKDGYVLYFSRSVIVQLSDAYLRHIGIYAYR
1e5kA           ---LAARLNHQRKDAPV--VWVH--DGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDF
3c8vA           FVCDGKI----PLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVA--PYANIHGSLTEGSFIGS
3c8vB           GQHFVCIPLHD------DEVITIKDSFLKTLVHSNSHPESPEEFTIRNTVA--PYANIHGSLTEGSFIGS
3d5nA           ---DVNKIINTFKPNC-KAVIPTHKGERGNPVLISKEKLRGDVGARVILNKIKIEELCFIECSEGVLIDI
3d5nG           ---DVNKIINTFKPNC-KAVIPTHKGERGNPVLISKSLFNEIEKLR-GDVGARVILNKIKIEELCFIECS
3d5nB           ----VNKIINTFKPNCK-AVIPTHKGERGNPVLISKSKLRGDVGARVILNKIKIEELCFIECSEGVLI--
2dpwA           GGN-------------------------------------------------------------------
3d5nH           ---DVNKIINTFKPNC-KAVIPTHKGERGNPVLISKSLFNLRGDVGARVILNKIEELCFIECSEGVLIDI
3d5nE           ----VNKIINTFKPNCK-AVIPTHKGERGNPVLISKSLFNEIEKLRGDVGAR-VILNKIKIEELCFIECS
3d5nI           ---DVNKIINTFKPNC-KAVIPTHKGERGNPVLISKSLFNEIEKLRG-DVGARVILNKIKIEELCFIECS
3ca8B           --ATFRRMTGDNPDAPRWLSYPG-FVPQLGNNADSVIQLQGLWPVERYLSLLTRDDSDGYGPRGRDFIVH
3dk5A           DADTLADLIATHRAV---SAAVTVLTTTLDDPFYG-------RIVMAIVE---------VNA--GVYAFD
3ca8A           --ATFRRMTGDNPDAPRWLSYPGF-VPQLGNNADSVIFINQERYLSLLTGELPRLRDDSDGYGPRGRDFP
3d5nF           ---DVNKIINTFKPNCK-AVIPTHKGERGNPVLISKSKLRGDVGARVILNKIKIEEL-------CFIECS
3c8vD           ---YKSDIRGDELKRKGQHFVCDGKIPLHDDEVITIKDSFLNKTLVHSNSHDPPYANIHGSLTEGSFIGS
2e8bA           ----VLYVLENFKEPVSVAKTEKLHYSKKLLEKIEERIKKGDYRIWALLKDVGYNEVEI--PEELRYTLL
2ehoB           ------------------CEKAELIRELHRAPEGQLPAFNEDGLRQVLEEKALYEQNQSDVNEAKSGGRS
3duvA           PPVIVRQVADNLAKFNVNASLAVKIHDAEELFNPNAVLTDKDGYVLYFSRSVIPYLSDAYLRHIGIYAYR
3cbtA           ----RENGGHVHIARPVTVVRDDADLLAVWLAPGTECVKPVLADGTPVHLEP---LATRYTKPRTVQRDQ
3eg4A           ----------------------------------------------------------------SLEKTI


                         .         .         .         +         .         .         .:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKF
2e3dC           ADIWPLLAKTPPGAGDEIQLTDAIDMLIE-KETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dD           ADIWPLLAKT--GAGDEIQLTDAIDMLI-EKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dB           ADIWPLL--------AKTQLTDAIDMLI-EKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dA           ADIWPLLAK----TPPEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
3d8vA           IAALRSALSSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVA---
3c8vC           SGDELE-----------------FHYSFDKAILDKYISQEAGSCPTGVLEFVEVRQEDF-----------
3cgxA           LPDWNDVDTYRTNKNSSFRRSSTYALLRENDALIRQYDI-------------------------------
3dj4A           IAALRSALSSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQ
3bbdA           KGERNHLIKEEKTLEDLLNENAKKIAITKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKV--------
3d98A           IAALRSALSSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVA------------------------
3brkX           GIYVFHTKFLEAVRRDAADIIPY-----------------------------------------------
2cu2A           PATMAEFRRHLPSHHEALERLLAGA-SLEEVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDV-------
3duvB           AGFIKQYVQWAPTQLENLEKLE-QLRVLYNGERIHVELAKEVPVGVDTAEDLEKVR--------------
1e5kA           SDHKDAF---------------------------------------------------------------
3c8vA           FATVDLSTIHNSVVRYFSY-------VQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAG
3c8vB           FATVDLSTIHNSVVRYFSYVQTGELVG-------------------------------------------
3d5nA           DK--------------------------------------------------------------------
3d5nG           EGVLI-----------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3d5nH           DK--------------------------------------------------------------------
3d5nE           EGVLIDID--------------------------------------------------------------
3d5nI           EGVLIDID--------------------------------------------------------------
3ca8B           VDFPAEVIHAWQHDAVLIEAMES-----------------------------------------------
3dk5A           IAALRALSRLSSNNQQELYLTDVIAILRSDGQTVHASH--------------------------------
3ca8A           AEVIHAWQ-TLKHDAVLIEAMES-----------------------------------------------
3d5nF           EGVLI-----------------------------------------------------------------
3c8vD           FATVDLSTIHNSVVRYFSY-------VQTGELVGKCVEPGQIWIKSG-----------------------
2e8bA           N---------------------------------------------------------------------
2ehoB           DLIPTIKFRHCSLLRNRRCTGSILPNAL-RFHAAEEEWFNNYKRSLATYRSLGGDGLDITQDKPPK----
3duvA           AGFIKQYVQWAPTQLENLEKLEQL-RVLYNGERI------------------------------------
3cbtA           WFGTGVLKLARPGEAWS------VWLFWDPG-----WRFKNWYVNLERPLTRWEGGVDS-----------
3eg4A           EKAFDERDNTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQ-----------------------


                         .         *         .         .         .         .         +:350
query           KEYLQNR
2e3dC           KAWLE--
2e3dD           KAWLEEE
2e3dB           KAWLEEE
2e3dA           KAWLEEE
3d8vA           -------
3c8vC           -------
3cgxA           -------
3dj4A           LAG----
3bbdA           -------
3d98A           -------
3brkX           -------
2cu2A           -------
3duvB           -------
1e5kA           -------
3c8vA           S------
3c8vB           -------
3d5nA           -------
3d5nG           -------
3d5nB           -------
2dpwA           -------
3d5nH           -------
3d5nE           -------
3d5nI           -------
3ca8B           -------
3dk5A           -------
3ca8A           -------
3d5nF           -------
3c8vD           -------
2e8bA           -------
2ehoB           -------
3duvA           -------
3cbtA           -------
3eg4A           -------