[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30798.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2aa4A.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "2ch5C.bssp"
#ERROR : Can't open dsspfile "3djcB.bssp"
#ERROR : Can't open dsspfile "1czaN.bssp"
#ERROR : Can't open dsspfile "1bg3B.bssp"
#ERROR : Can't open dsspfile "3djcD.bssp"
#ERROR : Can't open dsspfile "1dgkN.bssp"
#ERROR : Can't open dsspfile "2ch5A.bssp"
#ERROR : Can't open dsspfile "1bg3A.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "2ch6A.bssp"
#ERROR : Can't open dsspfile "3b8aX.bssp"
#ERROR : Can't open dsspfile "3bexA.bssp"
#ERROR : Can't open dsspfile "2dpnA.bssp"
#ERROR : Can't open dsspfile "3bf3C.bssp"
#ERROR : Can't open dsspfile "2ch6C.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "2ch6B.bssp"
#ERROR : Can't open dsspfile "1bu6Z.bssp"
#ERROR : Can't open dsspfile "3d7eO.bssp"
#ERROR : Can't open dsspfile "2ch5B.bssp"
#ERROR : Can't open dsspfile "1bu6O.bssp"
#ERROR : Can't open dsspfile "1botO.bssp"
#ERROR : Can't open dsspfile "1bu6Y.bssp"
#ERROR : Can't open dsspfile "1bwfY.bssp"
#ERROR : Can't open dsspfile "3c0bA.bssp"
#ERROR : Can't open dsspfile "2d4wA.bssp"
#ERROR : Can't open dsspfile "2e2nA.bssp"
#ERROR : Can't open dsspfile "2e2nB.bssp"
#ERROR : Can't open dsspfile "2e2qB.bssp"
#ERROR : Can't open dsspfile "2e2oA.bssp"

## Summary of PDB Search
:268
    9e-28  16%  2aa4A  [x.x.x] PUTATIVE N-ACETYLMANNOSAMINE KINASE
    1e-22  21%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    1e-21  16%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    1e-19  12%  2ch5C  [x.x.x] NAGK PROTEIN
    1e-19  13%  3djcB  [x.x.x] TYPE III PANTOTHENATE KINASE
    5e-19  11%  1czaN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    6e-19  11%  1bg3B  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    8e-19  14%  3djcD  [x.x.x] TYPE III PANTOTHENATE KINASE
    3e-17  11%  1dgkN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    1e-16  13%  2ch5A  [x.x.x] NAGK PROTEIN
    3e-16  11%  1bg3A  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    8e-16  20%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    1e-15  11%  2ch6A  [x.x.x] NAGK PROTEIN
    3e-14  10%  3b8aX  [x.x.x] HEXOKINASE-1
    8e-14  10%  3bexA  [x.x.x] TYPE III PANTOTHENATE KINASE
    1e-13  15%  2dpnA  [x.x.x] GLYCEROL KINASE
    1e-13   9%  3bf3C  [x.x.x] TYPE III PANTOTHENATE KINASE
    1e-13  12%  2ch6C  [x.x.x] NAGK PROTEIN
    3e-13   9%  1bdgA  [x.x.x] HEXOKINASE
    2e-11  16%  2ch6B  [x.x.x] NAGK PROTEIN
    7e-11   9%  1bu6Z  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
    9e-11  11%  3d7eO  [x.x.x] GLYCEROL KINASE
    1e-10  12%  2ch5B  [x.x.x] NAGK PROTEIN
    7e-10  10%  1bu6O  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
    3e-09   8%  1botO  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
    5e-09  10%  1bu6Y  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
    7e-09  11%  1bwfY  [c.55.1 - c.55.1] GLYCEROL KINASE
    2e-08  10%  3c0bA  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    4e-08  11%  2d4wA  [x.x.x] GLYCEROL KINASE
    6e-07  19%  2e2nA  [x.x.x] HEXOKINASE
    1e-06  19%  2e2nB  [x.x.x] HEXOKINASE
    1e-06  14%  2e2qB  [x.x.x] HEXOKINASE
    3e-05  14%  2e2oA  [x.x.x] HEXOKINASE
:268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
2aa4A           -----------TLAIDIGGTKLAAALIGADGQIRDRR-ELPTPASQTPEALRDALSALVSPLQ-AHAQRV
2ap1A           -----------YYGFDIGGTKIALGVFTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRF--GVKGSV
3bp8A           ----VETEAWHYLSLRISRGEIFLALRDSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLT
2ch5C           -----------YGGVEGGGTRSEVLLVSEDKILAEADGLSTNHWLIGTDKCVERINEMVNRAK-RKAGVD
3djcB           -----------ILCIDVGNSHIYGGVFDGDEIK---LRFRHTSKVSTSDELGIFLKSVLRENNCSPETIR
1czaN           -----------FIALDLGGSSFRIHEKNQNVHMESEVYDTPENVHGSGSQLFDHVAECLGDFMEKLPVGF
1bg3B           RSIPDGSEKGDFIALDLGGSSFRILRVQVNSMESEIYDTPENIVHGSGTQLFDHVADCLGDFMEDKKLPV
3djcD           -----------ILCIDVGNSHIYGGVFDGDIKLRFRHTSKVSTSDELGIFLKSVLRENNCSPETIRKIAI
1dgkN           RRTPDGTENGDFLALDLGGANFRVSGKKRTVEMHNKIYAIPIEMQGTGEELFDHIVSCISDFLDGPRMPL
2ch5A           -----------YGGVEGGGTRSEVLLVSEDKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDP
1bg3A           RSIPDGSEKGDFIALDLGGSSFRILRVVNVSMESEIYDTPENIVHGSGTQLFDHVADCLGDFIKDKKLPV
3bp8B           ----------------------------------------------------------------------
2ch6A           -----------YGGVEGGGTRSEVLLVSEDKILAEADGLSTNHWLIGTDKCVERINEMVNRAKR---KAG
3b8aX           -----------YLAIDLGGTNLRVGNHTFDTTQSKYKLPHDMRTTKHQEELWSFIADSLKDFMVTDTLPL
3bexA           ---------PMYLLVDVGNTHSVFSITEDGK--TFRRWRLSTGVFQTEDELFSHLHPLLGDAMR---EIK
2dpnA           -----------LLALDQGTTSSRAGRPVAVAKREFRQLYPKPGVEHDPLEIWETTLWAAREVLALGITNQ
3bf3C           ------------LLVDVGNTHSVFSITEDGKTFRRW--RLSTGVFQTEDELFSHLHPLLGDAMREIKGGV
2ch6C           -----------YGGVEGGGTRSEVLLVSEDG---KILAEADGLSTNGTDKCVERINEMVNRA----KRKA
1bdgA           TKTPNGTETGNFLALDLGGTNYRVLSVTLEGKSPRIQERTAEKMSGSGTELFKYIAETLADFLKKFDLGF
2ch6B           -------------GVEGGGTRSEVLADG-------------LSTNHIGTDKCVERINEMGVDPLVPLRSL
1bu6Z           ---------KYIVALDQGTTSSRAVVMDHDNIISVSQREFEQIYPKP-----GWVEHDPMEIWATQSSTL
3d7eO           -----------VMAIDQGTTSSRAIIFDRNKKIGSSQKEFPQYFPKSGWVEANEIWNSVQSVIAGAFIES
2ch5B           -----------YGGVEGGGTRSEVLLVSEDGKLAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDP
1bu6O           ---------KYIVALDQGTTSSRAVVMDHDNIISVSQREFEQIYPKPGWVEHDP------MEIWATQSST
1botO           ---------KYIVALDQGTTSSRAVVMANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKA
1bu6Y           -------EKKYIVALDQGTTSSRAVVMDHDANI-ISVSQREFEQIYPKPGWVEHDPMEIWA----TQSST
1bwfY           -------EKKYIVALDQGTTSSRAANIISVSQREFEQIYPKPGVEHDPMEIWATQSWTLVEV--------
3c0bA           -----------ILGIDIGGANTKITELHENEFKVHHLYFPDKLAEVLKTYSND-----------VSHVAL
2d4wA           ---------DYVLAIDQGTTSSRAIVF------DHSGEIYSTGQLEHDQIFPAGWVEHNPEQIWNNVREV
2e2nA           -----------IVGVDAGGTKTKAVAYDCENFIGEGSSGPGNYHNVGLTRAIENIKEAVKIA--------
2e2nB           -----------IVGVDAGGTKTKAVAYDCENFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAA-------
2e2qB           -----------IVGVDAGGTKTKAVAYDCEGNFIGEGSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVV
2e2oA           -----------IVGVDAGGTKTKAVAYCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVV


                         .         .         *         .         .         .         .:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXX
2aa4A           AIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGD-ITDMVFIT
2ap1A           GIGIPGMPETEDG-TLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPLVMGLI
3bp8A           SIALPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVV
2ch5C           PLVPL--RSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISSNCRLI
3djcB           KIAIQVDYSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQ---NIIVID
1czaN           TFSFPCQQSKIDERFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVN-DTVGTMMTCGYDDQHCEVGLI
1bg3B           GFTFSFPCRQSKIDEAVLITWTKDVVKLLNKAIKKRGDYDANIVAVVND-TVGTMMTCGYDDQQCEVGLI
3djcD           CSVVPQVDSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQ---NIIVID
1dgkN           GFTFSFPCQQTSLDAGILITATDCVGHDVVTLLRDAIKRREEFDLDVVNDTVGTMMTCAYEEPTCEVGLI
2ch5A           LVPLRSLGLSLSG---GDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTNCRL
1bg3A           GFTFSFPCRQSKIDWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVTVGTMMTCGYDDQQCEVGLI
3bp8B           -----------------------VKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVV
2ch6A           VDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGVLISGTGSNCRL
3b8aX           GFTFSYPASQNKINEGILQDIPNVEGHDVVPLLQNEISKRELPIEIVANDTVGTLIASYYTDPETKMGVI
3bexA           GIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIID
2dpnA           RETTLLWDRKTGKPLHNAIVWQDRRTTPLCEALRAKGLEPLFRERTGLLFDPY-----------------
3bf3C           ASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVA----FVKEYGKNGIIID
2ch6C           GVDPLVPLR-SLGLSLSGGEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGVLISGTGSNCRL
1bdgA           TFSFPCVQKGLTHATTKGFSADGVEGHNVAELLQTELDKRELNVKCVANDTVGTLASCALEDPKCAVGLI
2ch6B           GLSLSGGE---------------DAGRILIEELRDRFPYLYLITTDAAGSIATATPDGGVVLISGTGSNC
1bu6Z           VEVLTKADISSDQIAAIG-ITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTG
3d7eO           GIRPEAIAGI--------GITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTG
2ch5B           LVPLRSLGLSLSG---GDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTNCRL
1bu6O           LVEVLTKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTG
1botO           DISSDQIA--------AIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTG
1bu6Y           LVEVLTKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTG
1bwfY           ----LAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTG
3c0bA           VTTAEEGVDNILNAA----ESAFGSNISVFDSNGNFISLESAKTNKVSASNCGTAKWVSKNIEENCILVD
2d4wA           VGLALTRGNLTHEDIAAVGITNQRETAVVWDKTTGKPVYNAIVWQDTRTQKIVDELGGDEGAEKYK----
2e2nA           AKGEADVVGMGVAGLDS------KFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGT---
2e2nB           -------KGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGT---
2e2qB           GMGVA--------------GLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSV
2e2oA           GMGVAGLDS--------------KFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTNGK


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
2aa4A           VSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIGADAKTIFTRAGQGDEQAQQL
2ap1A           LGTGVGGGLVLNGKPITGQSYITGEFGCGCGQMGCIENYLSGRGFAWLYQHYYDQIIALWEQGDEQAHAH
3bp8A           IDHNVGAGVITDGHLLHAGSSSLVEIGHTQVNHGCLETIASVDSILELAQLTVDSLCQAALRGDLLAKDI
2ch5C           NPDGSESGCGGWGHMMGD-EGSAYWIAHQADIGYVKQAMFHYFQVKCRFAGFCRKIAEGAQQGDPLSRYI
3djcB           FGTATTFCAISHKKAYLGGAILPGLRLSADALSSTIESIQSGVYYLGACKELIQRIHHEAFNGDQILILA
1czaN           IGTGTNACYMEELRHIDLVEGDEGRMCINTE-----WGAFGDDGSLEDIRTEFDRAIDAYSLNPGKQLFE
1bg3B           IGTGTNACYMEELRHIDLVEGDEGRMCINT-----EWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFE
3djcD           FGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTASVE----IIKTESVVGRSTIESIQSGVY---YG
1dgkN           VGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGGCLDDIRTHQRYEKMIEIVRNILIDFTKKGFLFRGQI
2ch5A           INPDGSESGCGGWGHMMGDEGSAYWIAAPHDIGYVKQAMFHYDFDKCRFAGFCRKIAEGAQQGDPLSRYI
1bg3A           IGTGTNACYMEELRHIDLVEGDEGRMCINTEWGA-----FGDDGSLEDIRTEFDRELDRGSLNPGKQLFE
3bp8B           IDHNVGAGVITDGHLLHAGSSSLVEIGHTQVNHGCLETIASVQLRLNQSMSSMLSLCQAALRGDLLAKDI
2ch6A           INPDGSESGCGGWGHMMGDEGSAYWIAHPHDIGYVKQAMFHYFQVPCRFAGFCRKIAEGAQQGDPLSRYI
3b8aX           FGTGVNGAFYDVVSDIEKLEGKLADDIYGSFDNEHLVLPRTKVAVDEQSPRPGQQAFEKMTSGYY-----
3bexA           MGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPL--------VEVKPADFVVGKDTEENIRLGV
2dpnA           ----------------------------------------------------------------------
3bf3C           MGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTE--------ENIRLGV
2ch6C           INPDGSESGCGGWGHMMGDEGSAYWIAHPHDIGYVKQAMFHYFQVPDRFAGFCRKIAEGAQQGDPLSRYI
1bdgA           VGTGTNVAYIEDSSKVELMDGVKEPEVVINTEWGELDCWRTQQLYEKMVSGMYLGIVYLVEQKILFRGDL
2ch6B           RLINPDGSESGCGGWGEGSAYWIAHQAVKIVIDNLMFHYFQVPDRLCRFAGFCRKIAEGAQQGDPLSRYI
1bu6Z           LVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIW----------------------------
3d7eO           LVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWL------------------------------
2ch5B           INPDGSESGCGGWGHMMGDEGSAYWIAHQHDIGYVKQAMFHYDFDKCRFAGFCRKIAEGAQQGDPLSRYI
1bu6O           LVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWK---------------------------
1botO           LVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWK---------------------------
1bu6Y           LVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKM--------------------------
1bwfY           LVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDW
3c0bA           GSTTTDIIPIVEGKVVAEKTDLERLNHELLYVGTLTISFKGVDTNVSSEKVTTEEYTCDTPDGKGTDKRS
2d4wA           ----------------------------------------------------------------------
2e2nA           ----------------------------------------------------------------------
2e2nB           ----------------------------------------------------------------------
2e2qB           VEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLEQIDLVASIAKAVDEAANEGDTVAMDI
2e2oA           EFLRVGGRGWLLSDDGSAYWVGRKALRKVTILYNKVLKTINVKDLDELVASIAKAVDEAANEGDTVAMDI


                         .         .         .         +         .         .         .:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK
2aa4A           IHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGYLALVE-TYLAQEPAAFHVD---
2ap1A           VERYLDLLAVCLGNILTIVDPDLLVIGGGLSNFTAITT-QLAERLPRHLL--------
3bp8A           ITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHIS
2ch5C           FRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEG----------
3djcB           TGGFASLFDKQG--LYDHLVPDLVLQGIRLAAMM------------------------
1czaN           KMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSA-----------
1bg3B           KMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTFNTSDVSAIEKDKE--------
3djcD           VLGACKELIQRIHHEAFNGDQILILATGGFASLFDKQ---------------------
1dgkN           SETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILV-----------
2ch5A           FRKAGEMLGRHIVAVLPEIDPVPILCVGSVWKSWELLKEGFLLALTQGRA--------
1bg3A           KMVSGMYMGELVRLILVKMAKEGLLFEGRIT---------------------------
3bp8B           ITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHIS
2ch6A           FRKAGEMLGRHIVAVLPEIDPVPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
3b8aX           -------LGELLRLVLLELNEKGLMLKDQDLSK-------------------------
3bexA           VNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIKDMIKHEIFDEDLTIK---------
2dpnA           ----------------------------------------------------------
3bf3C           VNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKVKDMIKHEIFDEDLTI----------
2ch6C           FRKAGEMLGRHIVAVLPEIDPVLFLCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
1bdgA           PERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIV--------
2ch6B           FRKAGEMLGRHIVAVLPEIDPVPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
1bu6Z           ----------------------------------------------------------
3d7eO           ----------------------------------------------------------
2ch5B           FRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEG----------
1bu6O           ----------------------------------------------------------
1botO           ----------------------------------------------------------
1bu6Y           ----------------------------------------------------------
1bwfY           DDKMLEVLDIPREMLPEVRRSSEVYGQTNIGTRIPISGIAGD----------------
3c0bA           SLVRISKVLCSDLDQISEIDAE-NIAKNYYELWKELILENVENVAEKYGSKK------
2d4wA           ----------------------------------------------------------
2e2nA           ----------------------------------------------------------
2e2nB           ----------------------------------------------------------
2e2qB           LKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHK--------------------
2e2oA           LKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHK--------------------