[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30829.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bxjA.bssp"
#ERROR : Can't open dsspfile "1cqmA.bssp"
#ERROR : Can't open dsspfile "2bvzA.bssp"
#ERROR : Can't open dsspfile "3bbnF.bssp"

## Summary of PDB Search
:111
    3e-27  27%  2bxjA  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    7e-27  27%  1cqmA  [d.58.14] RIBOSOMAL PROTEIN S6
    2e-26  27%  2bvzA  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    2e-16  25%  3bbnF  [x.x.x] RIBOSOMAL PROTEIN S6
:111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
2bxjA           MRRYEVNIVLNPNLDSQLALEKEIIQRAAENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1cqmA           MRRYEVNIVLNPNLDSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDR
2bvzA           MRRYEVNIVLNPNLDSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
3bbnF           LRQYETMAVLRPDMTDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGYLLFTYFTKPES


                         .         .         *         .         .         .         .:140
query           LEKLQESLRYNDAILRRLVIATKEAIxxxxxxxxxxxxxxx
2bxjA           VNDAARELRIRDNVRRVMVVKSQEPF---------------
1cqmA           VNDLARELRIRDNVRRVMVVKSQEPF---------------
2bvzA           VNDAARELRIRDNVRRVMVVKSQEPF---------------
3bbnF           ISPLEAALVTDDDVIRSSSFKIRKR----------------