[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "3d7lA.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2eghA.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "3d7lD.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "3d7lB.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "2aw5A.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "1bdmA.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "1dj3A.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2a92B.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "3d7lF.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "1d4fA.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "2c82A.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "1b3rA.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "2e37C.bssp"
#ERROR : Can't open dsspfile "2e6gA.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "2e6gJ.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "2e37A.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "3e5mB.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "3e8xA.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "2e6eB.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "1a7aB.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "3dqpA.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "3e9nH.bssp"
#ERROR : Can't open dsspfile "3e9nF.bssp"
#ERROR : Can't open dsspfile "1edzA.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "2eezA.bssp"
#ERROR : Can't open dsspfile "3dfzB.bssp"
#ERROR : Can't open dsspfile "1a4iA.bssp"
#ERROR : Can't open dsspfile "3donA.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "1buaB.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "2e6gG.bssp"
#ERROR : Can't open dsspfile "1cg4A.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "1a7aA.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "1a4iB.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "1ddtA.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "2e6gB.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2ef0A.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "3dbrG.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "3d5tA.bssp"
#ERROR : Can't open dsspfile "3c1oA.bssp"
#ERROR : Can't open dsspfile "3bywA.bssp"

## Summary of PDB Search
:235
    4e-39  30%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-38  19%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-38  31%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    8e-37  23%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    9e-37  28%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    2e-36  22%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    5e-36  20%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    7e-36  20%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-35  24%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    1e-35  19%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-35  20%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-35  26%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    3e-34  18%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-34  28%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    6e-34  18%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-33  18%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-33  30%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-33  31%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-32  27%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-32  11%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    2e-31  25%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    2e-31  20%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-31  18%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    3e-31  28%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    3e-30  18%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-30  20%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-30  11%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    8e-30  32%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    9e-30  19%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-29  27%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    2e-29  10%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-29  21%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-29  18%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    3e-29  21%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    5e-29  22%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-29  19%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-29  28%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    9e-29  18%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-28  24%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-28  21%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-28  28%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    1e-28  24%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-28  17%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    4e-28  22%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-27  12%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-27  16%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    2e-27  29%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    6e-27   8%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    8e-27   9%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    9e-27  19%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    1e-26  22%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-26  18%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    5e-26  21%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    6e-26  16%  3d7lA  [x.x.x] LIN1944 PROTEIN
    7e-26  29%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    8e-26  26%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    1e-25   9%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-25  20%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-25  19%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-25  14%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    2e-25   6%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-25   8%  2eghA  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    3e-25  19%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-25  23%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    5e-25  24%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    7e-25  18%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-24  19%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-24  22%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-24  10%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-24  12%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-24  29%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-24  22%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-24  20%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-24  23%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-24  19%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-24  16%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-24  11%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    5e-24  17%  1c14A  [c.2.1] ENOYL REDUCTASE
    5e-24  17%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-24  22%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-24  19%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-24  19%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-24  10%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    7e-24  28%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    9e-24  15%  3d7lD  [x.x.x] LIN1944 PROTEIN
    9e-24  22%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-23  23%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-23  16%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    1e-23  22%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    1e-23  11%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    1e-23  19%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-23   9%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    4e-23  19%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-23  17%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    5e-23  26%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    5e-23  19%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-23  19%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    7e-23  25%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-23  13%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    7e-23  19%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-22  30%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    1e-22  12%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-22  28%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    2e-22  18%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-22  20%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-22  20%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-22   9%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    6e-22  19%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    6e-22  10%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    8e-22  10%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    9e-22  15%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-21  15%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    1e-21  30%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    2e-21  26%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-21  16%  3d7lB  [x.x.x] LIN1944 PROTEIN
    2e-21  17%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-21  26%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-21  11%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    4e-21  20%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-21  18%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    5e-21  27%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    6e-21  22%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    8e-21  28%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    8e-21  21%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    8e-21   9%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-20  22%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-20  22%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-20  26%  1cydA  [c.2.1] CARBONYL REDUCTASE
    2e-20  28%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    2e-20  17%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    2e-20  19%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-20  22%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    3e-20  20%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-20  21%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    6e-20  10%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    6e-20  17%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    6e-20  26%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    8e-20   9%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    8e-20  26%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    9e-20  21%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-19  25%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    1e-19  25%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    2e-19  33%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    2e-19  25%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-19  25%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-19   9%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-19   7%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    2e-19   6%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    2e-19  26%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    3e-19  25%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    3e-19  10%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    3e-19   9%  2aw5A  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    3e-19  23%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    4e-19  23%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-19  10%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-19  27%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    6e-19  25%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    6e-19  27%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    7e-19  16%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-19  19%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-19  17%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    9e-19  28%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    1e-18  25%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-18   9%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    2e-18  22%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-18   9%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-18  26%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    2e-18  18%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-18  23%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-18  16%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    4e-18  12%  1bdmA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    4e-18  10%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    5e-18  27%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    6e-18  11%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    6e-18  24%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    6e-18   7%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    7e-18  12%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    8e-18  24%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    9e-18  11%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    1e-17  13%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-17   9%  1dj3A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    1e-17  26%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    1e-17  26%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    1e-17   9%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-17  26%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    2e-17  11%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-17  26%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    3e-17  27%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    4e-17  28%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    4e-17  24%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    5e-17  26%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    5e-17  25%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    5e-17   9%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    6e-17  13%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    8e-17  10%  3e6vA  [x.x.x] ARGINASE-1
    8e-17  13%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    8e-17  28%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    9e-17  28%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    1e-16   9%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    1e-16  13%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-16   9%  2a92B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-16  25%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    3e-16  27%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    3e-16  25%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    6e-16  28%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    6e-16   9%  2bllA  [x.x.x] PROTEIN YFBG
    7e-16  26%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    9e-16  15%  3d7lF  [x.x.x] LIN1944 PROTEIN
    9e-16  12%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    1e-15  26%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    1e-15  11%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-15  27%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-15  11%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    3e-15  11%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    3e-15  13%  1d4fA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-15  26%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    4e-15  11%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    4e-15  12%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    5e-15  26%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    5e-15   6%  2c82A  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    5e-15  26%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    8e-15  13%  1b3rA  [c.23.12 - c.2.1] PROTEIN (S-ADENOSYLHOMOCYSTEINE HYDROLASE)
    8e-15  11%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    1e-14  19%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-14   8%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    1e-14  13%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-14  25%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    2e-14  12%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-14   9%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    2e-14  12%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-14  11%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-14  26%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    3e-14  11%  2e37C  [x.x.x] L-LACTATE DEHYDROGENASE
    6e-14  11%  2e6gA  [x.x.x] 5'-NUCLEOTIDASE SURE
    7e-14  26%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    1e-13  11%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    2e-13  11%  2e6gJ  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-13  12%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-13  13%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-13  10%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    6e-13  19%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    7e-13   9%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    1e-12  10%  2e37A  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-12   9%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-12   8%  3e5mB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    3e-12  13%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-12  15%  3e8xA  [x.x.x] PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    4e-12  19%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    6e-12  10%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    8e-12   8%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    9e-12  17%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-11  10%  2e6eB  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-11  13%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    2e-11   9%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-11  10%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    3e-11   5%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    3e-11  10%  1a7aB  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    5e-11   8%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    6e-11  19%  3dqpA  [x.x.x] OXIDOREDUCTASE YLBE
    7e-11  11%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    8e-11  17%  3e9nH  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    9e-11  17%  3e9nF  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-10  13%  1edzA  [c.58.1 - c.2.1] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE
    1e-10  17%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    4e-10  15%  1bw3A  [x.x.x] BARWIN, BASIC BARLEY SEED PROTEIN
    1e-09  11%  2eezA  [x.x.x] ALANINE DEHYDROGENASE
    2e-09  11%  3dfzB  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    3e-09   7%  1a4iA  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    5e-09   8%  3donA  [x.x.x] SHIKIMATE DEHYDROGENASE
    1e-08  11%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    3e-08  13%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    5e-08   9%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    5e-08  12%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-08  12%  1buaB  [c.52.1] ENDONUCLEASE ECORV
    7e-08   7%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    1e-07  10%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-07  11%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-07   9%  2e6gG  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-07  10%  1cg4A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-07  10%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    3e-07   7%  1a7aA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-07  12%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    4e-07   7%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    5e-07   8%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    7e-07  10%  1a4iB  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    8e-07   9%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    9e-07  12%  1ddtA  [d.166.1 - f.1.2 - b.2.1 (1mdtA)] DIPHTHERIA TOXIN
    1e-06  11%  1d0iA  [c.23.13] TYPE II 3-DEHYDROQUINATE HYDRATASE
    2e-06  12%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    2e-06   8%  1adeA  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    1e-05  12%  2e6gB  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-05  13%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    5e-05  10%  2ef0A  [x.x.x] ORNITHINE CARBAMOYLTRANSFERASE
    6e-05  10%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    9e-05  10%  3dbrG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    1e-04  17%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    5e-04   5%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    6e-04  11%  3d5tA  [x.x.x] MALATE DEHYDROGENASE
    7e-04  14%  3c1oA  [x.x.x] EUGENOL SYNTHASE
    0.001  11%  3bywA  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
2d1yB           FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRGKEVAEAIGGAFDLEDERERVRFVEEAAYALGRV
3czrA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKLELGAASAHYGTMEDMTFAEQFVAQAGKLMGGL
2d1yA           FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRVAEAIGGAFFQVDLEDERERVRFVEEAAYALGRV
1dohB           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANAIKKNGSDAACANVGVVEDIVRMFEEAVKIFGKL
2ae1A           LEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVANHFHGK
1a27A           -ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATACPPGSLETLQLDVRDSKSVAAARERV--TEGRV
1dfiA           LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDLGSDIVLQCDVAEDASIDTMFAELGKVWPKF
2belC           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2cfcA           --SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSADKVLRVRADVADEGDVNAAIAATMEQFGAIDVL
3d3eA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSCLELGAASAHYGTMEDMTFAEQFVAQAGKLMGGL
3d5qC           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSCLELGAASAHYGTMEDMTFAEQFVAQAGKLMGGL
3bmoB           MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEIINSCFRA
3bzuB           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSCLELGAASAHYGTMEDMTFAEQFVAQAGKLMGGL
2ag5A           LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQI----DQFANEVERL
3ch6E           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
3ch6B           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2d1yC           FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRGKEVAEAIGGAFDLEDERERVRFVEEAAYALGRV
2d1yD           -AGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRVAEAIGGAFFQVDLEDERERVRFVEEAAYALGRV
2a4kA           LSGKTILVTGAASGIGRAALDLFAREGASLVAVDREAVAALEAEAIVADVSDPKAVEAVFAEALEEFGRL
1a9zA           -----VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSGGKHPTFVEGDIRNEALMTEILHDHAIDTVI
3deyX           -ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDKTQGRLLQLDVRDSKSVAAARERVTEGR--V
2belA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSCLELGAASAHYGTMEDMTFAEQFVAQAGKLMGGL
3ctmF           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTI
3d3wA           LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVPGIEPVCVDLGDWEATERALGSVGPV
2b35E           LDGKRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
3d5qD           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
1dj2A           SELAKSFIGTTKRGIGPAYSSKVIRNGIRVGDLRHMDTLPDAAARFQGFKYTPEMLREEVEAYKRYADRL
1edoA           ---PVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEITFGGDVSKEADVEAMMKTAIDAWGTI
2b35A           LDGKRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRLRAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
2b4qB           LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDLSAYGDCQAIPADLSSEAGARRLAQALGELSARL
3ce6B           LIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINALQAMMEGDIVVTATGNKDIIMLEHIKAMKD
3ek2B           LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDFGSELVFPCDVADDAQIDALFASLKTHWDSL
3ctmH           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTI
3ek2A           LDGKRILLTGLLSNRSIAYGKACKREGAELAFTYVGDRFKDRITEFPCDVADDAQIDALFASLKTHWDSL
3e03C           LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPQGLALKCDIREEDQVRAAVAATVDTFGGI
2belD           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVHYIAGTMEDMTFAEQFVAQAGKLMGGL
2ag5B           LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFANE----VERL
3dwfB           LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGL
2dknA           ----VIAITGSASGIGAALKELLARAGHTVIGIDRGQADAVAAVLDRCGGVLDGLVCCAGVGVTAANSVV
3edmB           FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKFGEI
2ag5C           LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFA----NEVERL
2ehdA           MK-GAVLITGASRGIGEATARLLHAKGYRVGLMARDLAAELEGALPLPDVREEGDWARAVAAMEEAFGEL
1d7oA           LRGKRAFIAGIADDYGWAVAKSLAAAGAEILVGTWVDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSI
3e03B           LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPQGLALKCDIREEDQVRAAVAATVDTFGGI
2cnbB           -SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSGPKPPWADRYAALEVGDVRNEDFLNGVFTRHGPI
1dhrA           --ARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASAKMTDSFTEQADQVTAEVGKLLGDQKVD
3csdB           QDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGREAGVEADGRTCDVRSVPEIEALVAAVVERYGPV
2e6hB           -----------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDHITIAHPV
2e6gK           -----------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDTITIAHPV
1cwuA           LRGKRAFIAGIDNGYGWAVAKSLAAAGAEILVGTWVDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSI
3ek2C           LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITECDVADDAQIDALFASLKTHWDSL
3e9qA           LNDRIILVTGASDGIGREAATYARYGATVILLINEETGRQPQWFILDLLTCTSENCQQLAQRIVVNYPRL
3ek2D           LDGKRILLTGLLSNRSIAYGIACKREGAELAFTYVGEFAAEFGSELVCDVADDAQIDALFASLKTHWDSL
3d7lA           -SNAKILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTV------------DITNIDSIKKYEQVGKV
2ekpA           ---RKALVTGGSRGIGRAIAEALVARGYRVAIAAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLH---
3bmeC           ---PAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNELNKERSNTAVADLTNSNVLPASCEEIINSCFRA
2e6cC           -----------------------------------------------PDTEQSAA-----GHAITIAHPV
3d4nD           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVHYIAGTMEDMTFAEQFVAQAGKLMGGL
3d5qB           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2dfdA           --NAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVK----GYLGPEQLP
1c3vA           -----VGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGVVIDFTHPDVVMGNLEFLIDNGI
2eghA           ---KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRT
2b36B           LDGKRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
3dijA           --NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRI
3diiA           --NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRI
3ch6A           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2b35C           LDGKRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
3dwfA           LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGL
1bmdA           MKPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLVVMELEDCAFPLLAGLEATDDPDVAFKDAD
3ce6A           LIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDGFDVVTVEEAIDIVVTATGNKDIIMLEHIKAMKD
2a4kB           LSGKTILVTGAASGIGRAALDLFAREGASLVAVDREAVAALEAEAIVADVSDPKAVEAVFAEALEEFGRL
1dohA           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKL
3d4nC           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVHYIAGTMEDMTFAEQFVAQAGKLMGGL
3dwfC           LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGL
2aqkA           LDGKRILVSGIISSIAFHIARVAQEQGAQLVLTGFDPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
3ch6D           LQGKKVIVTGASKGIGREMATARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2aw5C           KLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKDSKGLIVKGQEKEKFAHEHEEMKNLEAIVQEIKP
1c14A           LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKF
2b37C           LDGKRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLAKLDG
3e03A           LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPQGLALKCDIREEDQVRAAVAATVDTFGGI
3d4nB           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVHYIAGTMEDMTFAEQFVAQAGKLMGGL
3byzA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCGTMEDMTFAEQFVAQAGKLMGGL
3c6cA           ----------------------------------------------------------------------
1ahhA           ---KCAIITGAGAGIGKEIAITFATAGASVVVSDINQQLGGQAFACRCDITSEQELSALADFAISKLGKV
3d7lD           --NAKILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVDITNIDSI------------KKYEQVGKV
1bhsA           -ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWLDVRDSKSVAA--ARERVTEGRV
3edmA           FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKFGEI
3bhmA           ---HVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGL
2bgkA           LQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIAIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKL
3ce6D           LIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKD
3bzuA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCGTMEDMTFAEQFVAQAGKLMGGL
2aw5B           KLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKDSKGLIVKGQEKEKFAHEHEEMKNLEAIVQEIKP
2aqiA           LDGKRILVSGIDSSIAFHIARVAQEQGAQLVLTITDRLPAKAPLLELQNEEHLASLAGRVTEAIGAGNKL
3ctmG           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHYKCNISDPKS----VEETISQQEKD
2ehdB           GMKGAVLITGASRGIGEATARLLHAKGYRVGLMARDLAAELEGALPLPDVREEGDWARAVAAMEEAFGEL
3bzuD           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARETLQKVVSHCLELGAASMTFAEQFVAQAGKLMGGL
2aq8A           LDGKRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLRLPLLELDVQNEEHLASLAGRVTEAIGAGNKL
2dknB           ----VIAITGSASGIGAALKELLARAGHTVIGIDRGDLSTPGGRETAAVLDRCGGVLDGLVCCAGVNSGL
2e6hD           -----------------------------------------------PDTAGHAI---------TIAHPV
2b35D           LDGKRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
2ekqD           ---RKALVTGGSRGIGRAIAEALVARGYRVAIQSLGAVPLPTDLEKDDPKGLVKRALEAL-------GGL
2cnbC           -SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSGPKPPWADRYAALEVGDVRNEDFLNGVFTRHGPI
2ae2A           LEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNRSKGFKVEASVCDLSSRSERQELMNTVANHFHGK
2belB           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
2b35B           LDGKRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKL
3d3eB           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLTMEDMTFAEQFVAQAGKLMGGL
1bxkB           ---RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSERFAFEKVDICDRAELARVFTEHQP
3ctmA           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHTYGVHSKAYKCNISDPKSVEETISQQEKDFGTI
3d3uA           PIAEVLPGSDLELRIGQNCASLIKDGDTLQLGIGGIPDAVLRALEGHKDLGIHTEMFTDGVMRMIRKGII
3cq0B           LILAASKLEKYARFIDAAVEYGRKHGKTDHEKIENAQILKVVPGRTEVDARLSFDKKATVKKALHIIKLY
2cnbA           -SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVV
3ctmB           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEET
2c07A           GENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQSFGYESSGYAGDVSKKEEISEVINKILTEHKNV
2bfaA           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
3d7lB           -----ILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVDITNIDSI------------KKYEQVGKV
2aqhA           LDGKRILVSGIITDVAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRQNEEHLASLAGRVTEAIGAGNKL
2b4qA           LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDEAGARRLAQALGELSARL
1a9yA           -----VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIEGDIRNEALMTEILHDHAIDTVI
3d4nA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
3ctmE           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPAGVHSKAYKCNISDPKSVEETISQQEKDFGTI
3cxtA           LKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDNAHGYVCDVTDEDGIQAMVAQIESEVGII
1e3sA           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGEVQAALTLAKEKFGRIDVAVNC
1ae1A           LKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRVFDGKL
2bd0A           ---HILLITGAGKGIGRAIALEFARAARHHPDFEPVLVLSSLTDTITADISDMADVRRLTTHIVERYGHI
2e37D           -----VGIVGSGVGSATAYALALLGVAREVVLVDLDRKLPFAHPVWVRAGSYGDLEGARAVVLAAGVARL
2b35F           LDGKRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDDRLPAKAPLLELDVQNEEHLASLAGRVTEAIGAG
1e3wA           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLKEVQAALTLAKEKFGRIDVAVNC
1cydA           FSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECEPVCVDLGDWDATEKALGGIGPV
1ae1B           LKGTTALVTGGSKGIGYAIVESRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFDGKL
1a4uA           LTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPKVNITFHTYDVTVPVAESKKLLKKIFDQLK
3d5qA           LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASFAEQFVAQAGKLMGGL
2bf7A           ----VALVTGAAKRLGRSIAEGLHAEGNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVL
2b37B           LDGKRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDVQNEEHLASLAGRVTEAIGAGNKL
1bdbA           LKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAVLGIVGDVRSLEDQKQAASRCVARFGKIDTLIP
2a92C           -TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVSNSYDDLKG
3ctmD           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEET
3bmnD           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQAFRAFGRCDV
3c2qA           --ALAKVELGYIQAILAGNALATHDIESALYGTSLGTGGHKHHIYAINAINDAGNIKNAVESGVLKEGIY
3cxrA           LKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGIEDGIQAMVAQIESEVGII
1e6wB           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEAPANVTSEKEVQAALTLAKEKFGRIDVAVNC
2bfmB           ----VALVTGAAKRLGRSIAEGLHAEGRPNSAITVQADLSNVATAPVAPVTLFTRCAELVAACYTHWGRC
1e7wB           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRTVQADLSNVATAPVTLFTRCAELVAACYTHWGRC
2dteA           LRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSI
2bfpB           -TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSCAELVAACYTHWGRC
2bfoA           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAENVATAPVAPVTLFTRCAELVAACYTHWGRC
2e6bC           -----------------------------------------------PDTHAITIAH--PVRAYPHPSPL
3e48A           ------ILTGATGHLGTHITNQAIANHIDHFHIGVRDDWRGKVSVRQLDYFNQESVEAFKGDTVVFIPSI
1b8pA           -TPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVIKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDA
3bmqA           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNGRCDV
1e92A           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANVATAPAPVTLFTRCAELVAACYTHWGRC
1c9yA           LKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGG
2aw5A           KLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDQEKEKFAHEHEEMKNLEAIVQEIKP
2bf7B           -TVPVALVTGAAKRLGRSIAETLNARRPNSAITVQADLSNVATAPSAPVTLFTRCAELVAACYTHWGRCD
1e6wC           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIALTLAKEKFGRIDVAVNC
2e6cD           ------------------------------------------EVFVAAPDTHAITIAHPVRAYPHPSPL-
2c7vD           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQANSCFRAFGRC
3bmfB           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADEADLTNSNVLPASCEEIINSCFRA
2bfaD           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
3bzuC           LQGKKVIVTGASKGIGREMAYARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGL
3edmD           FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAEGGRSALAIKADLTNAAEVEAAISAAADKFGEI
3e9qB           LNDRIILVTGASDGIGREAATYARYGATVILLGRNEEKLRQVASHINLLTCTSENCQQLAQRIVVNYPRL
2c7vB           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVGRC
2bfaB           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
3c2qB           ------VELGYIQAILAGNALATHDIESALYGTSLGVNIKTAHIYAINAINDAGNIKNAVESGVLKEGIY
1e6wD           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAAVNC
2e6bD           ---------------------------------------------VAAPDTHAITIAHPVRAYPHPSPL-
3bmnB           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELSNVLPASCEEIINSCFRAFGRC
3edmC           FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKFGEI
1e6wA           VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFATLAKEKFGRIDVAVNC
3ctmC           LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEET
1bdmA           MKPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEATD
2e37E           -----VGIVGSGVGSATAYALALLGVAREVVLVDLDRKLTPFAHPVWVRAGSYGDLEGARVAQRPGETRL
3bmnC           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELSNVLPASCEEIINSCFRAFGRC
2axqA           ---KNVLLLGSG-FVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKAISLDVTDDSALDKVLADN
1e92B           -TVPVALVTGAAKRLGRSIAEATLNARRPNSAITVQADLSNVATAPSAPVTLFTRCAELVAACYTHWGRC
1di6A           -----LVSISDRDKGIPALEEWLTSALTTPFELET------------RLIPDEQAIIEQTLCELVDEMSC
2e6hC           -----------------------------------------------APDGHAITIAHPV----RAYPHP
1e7wA           -TVPVALVTGAAKRLGRSIAEGLHAEGYAAITVQADLSNVATAPVSSAPVTLFTRCAELVAACYTHWGRC
3dhnA           --VKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKIKI---------------ENEHLKVKKADVS
1c9kB           ----MILVTGGARSGKSRHAEALIGDAPQVLYIATSQQHHKDGRPAHWRTAECWRHLDTLITADLAPDDA
1dj3A           AELANSFIGTTKRGIGPCYSSKVTRNGLRVCDLRHMDTFGDKLDVLFEDRFEGFKYSKGMLKEEVERYKK
2c7vA           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNNKERSNTAVVQADLTNSNVLPASCEEIINSCFRA
3bmfC           --APAAVVTGAAKRIGRAIAVHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLASCEEIINSCFRAF
2e37B           -----VGIVGSGVGSATAYALALLGVAREVVLVDLDRKLAQAHAEWVRAGSYGDLEGARAVVLAAGVARL
3bmdB           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAASCEEIINSCFRAF
3d64A           MIAGKIAVVAGYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGDIFVTATGNYHVINHDHMKAMRH
3bmoA           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEANTAVVCQADLTNSNVLPASCEEIINSCFRA
3bmiB           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAVVCQADLTNSNVLPASCEEIINSCFRAFGR
3bmqC           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQASCFRAFGRC
1e92D           -TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAP
2bfoC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRTVQADLSNVATAPVTLFTRCAELVAACYTHWGRC
3bmfD           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAVVCQADLTNSNVLPASCEEIINSCFRAFGR
3dxfB           ---KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTVQGDQDDQVIMELALNGAYATFIVTNSQEQEVKQG
1bsvA           ---QRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELN-----LLDSRAVHDFFASERIDQVYLAAAK
3e6vA           -NGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDITTTSGNLHGQPVSFLLKELKGKIPDVPGF
1e7qA           ---QRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLL-----DSRAVHDFFASERIDQVYLAAAK
2c7vC           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVGRC
3bmoD           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELDLTNSNVLPASCEEIINSCFRA
1bxkA           ---RKILITGGAGFIGSALVRYIINETSDAVVVVDKMSLAPVAQSERFAFEKVDICDRAELARVFTEHQP
2c5aB           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2a92B           -TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVV
3bmeA           --APAAVVTGAAKRIGRAIAVYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRA
1e92C           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATAPVTLFTRCAELVAACYTHWGRC
3bmfA           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTASNVLPASCEEIINS
3bmjD           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADEADLTNSNVLPASCEEIINSCFRA
2bllA           -----VLILGVNGFIGNHLTERLLREDHYEVYGLDILNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLV
2bfpD           -TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITLVAACYTHWGRC
3d7lF           -----ILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVD------------ITNIDSIKKYEQVGKV
3dfzA           LKGRSVLVVGGG-TIATRRIKGFLQEGAAITVVAPTRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKN
3bmkC           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELDLTNSNVLPASCEEIINSCFRA
1c9kA           ----MILVTGGARSGKSRHAEALIGDAPQVLYIATSQIARIQHHKDGRPAHWRTAECWRHLDTLITADLA
2bfmC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAELSNVATAAPVTLFTRCAELVAACYTHWGRC
2c29F           --SETVCVTGASGFIGSWLVMRLLERGYTVRATVRDETHLTLWKADLADEGSFDEAIKGCTGVFHVATPM
3c3xA           MK-SKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKV
1d4fA           MIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIEPINALQAAMEGYEVTTMDEAVDIILGRHFEQMKD
2bfaC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATAPVTLFTRCAELVAACYTHWGRC
2bkaA           MQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGH
1d4gA           -----------------------------------------------NIFVTTTGCVDIILGRHFEQMKD
3bmnA           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCINSCFRAFGRC
2c82A           ---LRVVVLGSTGSIGTQALQVIADNPDRFEVVGLLLRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAA
2bf7C           ---PVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQAACYTHWGRC
1b3rA           MIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINMDEACKEGNIFVTTTGCVDIILGRHFEQMKD
1bdmB           MKPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPALEGVVMELEDCAFPLLAGLEATDDPD
3e9nA           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGV------EPIESDIVKEVLEEGG
3dxfA           ---KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPRKKAKELRLQGAEVVQGDQDDQVIMELALNGA
2c5eB           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
3bmeB           --APAAVVTGAAKRIGRAIAHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRA
2c59B           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCMENCLKVTEGVDHVFNLAADMGG
3e5mA           ---KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRKAAKELRLQGAEVVQGDQDDQVIMELALNGAYAT
1e7sA           ---QRVFIAGHRGMVGSAIRRQLEQRGDV-----ELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK
2c54A           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDENCLKVTEGVDHVFNLAADMGG
3bmoC           --APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCINSCFRAFGRC
2e37C           -----VGIVGSGVGSATAYALALLGVAREVVLVDLDILHATPFAHPVVRAGSYGDLEGARVAQRPGETRL
2e6gA           ------------------------------------------------------------------PAPH
2bf7D           -TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAELSNVATAPPVTLFTRCAELVAACYTHWGRC
2a35A           -TPKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDGSIDTAFCC
2e6gJ           ----------------------------------------------------------------------
2c59A           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2c54B           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
1ek5A           MA-EKVLVTGGAGYIGSHTVLELLEAGRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSF
3e9nB           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAAL-----AEIEGVEPIESDIVKEVLEEGGV
1di7A           --------------------------------------------LETRLIPDEQAIIEQTLCELVDEMSC
2e37A           -----VGIVGSGVGSATAYALALLGVAREVVLVDLDRKLAQAHAEDIVRAGSYGDLEGARVAQRPGETRL
1cg3A           KARGAKAIGTTGRGIGPAYEDKVALRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDKVLDDT
3e5mB           ---KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAGDQDDQVIMELALNGAYAT
2c5eA           SENLKISITGAGGFIASHIARRLKHEGHYVIASDMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
3e8xA           -----VLVVGANGKVARYLLSELKNKGHEPVAVRNEEQGPE----LRERGASDIVVANLEEDFSHAFASI
3e9nC           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIE------SDIVKEVLEEGG
1cbuC           ----MILVTGGARSGKSRHAELYIATSQILDDEMAARIQHHDGRPAHWRTAECWRHLDTLITADLAPDDA
3d3jA           ---ALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPV
3e9nE           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKN
2e6eB           -----------------------------------------------FVAAPDTTIAHPVRAYPHPSPPH
1bwsA           ---QRVFIAGHRGMVGSAIRRQLEQRGDVEL-----VLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK
2e6eD           -----------------------------------------------PDIAHPVRAYPHPPHFPAYRVRG
2c20A           -----ILICGGAGYIGSHAVKKLVDEGLSVVVVDNLHEDAITEGAKFYNGDLRDKAFLRDVFTQENIEAV
3dtdB           ------------------------YGLWSINCGIQEGKKVC--FMHRQEVNDQNRVVVAMSVVLNADGVV
1a7aB           VIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAQEGNIFVTTTGCIDIILGRHFEQKDD
2a92A           -TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSYSNCKVTGSNSYDDLKGADVV
3dqpA           -----IFIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQ-------------------YNNVKAVHF
2cukA           -------------RIGQAVAKRALAFGMRVVYHARTPKPLPYADVVSLHTPLTPETHRLLNRERLFAMKR
3e9nH           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAA----LAEIEGVEPIESDIVKEVLEEGGVD
3e9nF           ---KIAVVTGATGGMGIEI------VKDLSRDHIVYALGRPEHLAALAEIEGVEPIESDIVKEVLEEGGV
1edzA           LYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGLKLNKHHVEDLGEYSEDLLKKCSLDS
3e9nD           ---KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVE-----PIESDIVKEVLEEGGV
1bw3A           --HYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGGQAACGKCLRVTNPATGAQITARIVDANGGL
2eezA           -----VVILGGG-TVGTNAAKIALGMGAQVTILDVKRLQYLDDVFGGRLTATEANIKKSVQHADLLIGAV
3dfzB           LKGRSVLVVGGG-TIATRRIKGFLQEGAAITVVAPTQLRVKRKKVGEEDLLFIVVATNDQAVNKFVKIKN
1a4iA           IAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGGEWIKPGAIVIDCGINYKVVGDV
3donA           ------------------------------------------------------------------LSHA
3d5tC           --AKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVI--------LQLLDLPQAQAAVKGVVMVVITDDPK
1e6uA           -AKQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDEL-----NLLDSRAVHDFFASERIDQVYLAAAK
1civA           KKIINVAVSGAAGMISNHLLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMELEDSLYPLLRQFQDA
2c5aA           SENLKISITGAGGFIASHIARRLKHEGHYVIASDWMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMG
1buaB           ----------------------------------------------------------------------
3dooA           ----------------------------------------------------------------------
3bywF           -DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELPADATIAISATEDETTAGIEGDDSTTETV-E
3bywB           -DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHELAQLPADATISATEDETTAGIEGDDSTT-ETVE
2e6gG           -----------------------------------------------DTITIAHPVRAYPHPSPLHAPH-
1cg4A           ------AIGTTGRGIGPAYEDKVARRGLRVGDLFD--KETFAEKLEAVDYQKVLDDTMAVADILTSMVVD
3eheA           ----LIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLKGAEEVW
1a7aA           -----------------------------------------------NIFVTTTGCIDIILGRHFEQKDD
2a35B           -TPKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNP----------------VGPLA
2eggA           ----------------------------------------------------------------------
1cg1A           --RGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEDTMAVADIL
1a4iB           IAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGI
3bywC           --QDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELPADATIAISATEDETTAGIEGDDVERDVRPI
1ddtA           ----------------------------------------------------------------------
1d0iA           ---PIMILNGPNLNL-------LGQRQPEIYGSDTLAVKAAAAHGGTVDFRQSNHEGELVDWIHEARLNH
3e48B           ------ILTGATGHLGTHITNQAIANHIDHFHIGVRDDWRGKVSVRQLDYFNQESVEAFKGDTVVFIPSI
1adeA           -----KAIGTTGRGIGPAYEDKVARRGLRVGDLFDEYHNFQLVNYYKAEAVDYQKVLDDTMAVADIMVVD
2e6gB           -----------------------------------------------PIAHPVRAYPHPS----PLHAPH
2dt8A           ---RITLVTDSTSDLPQDLRGRL---GVRVVPLYVNLSGREGAAFPTTSQPSPEDFARVYREALEEADHV
2ef0A           LAGLEVAWVGDGNNVLNSLLEVAPLAGLKVRVATPKGYEPDPGLLKREAALGAHALYTDVWTEKRLRDFQ
3bywH           -DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLTIAISATEDETTAG--IEGDDSTTETV
3dbrG           LESAHVCLINAT-ATGTEILKNLVLPGIGSFTIIDQVSGEDAGNNFFLQRSSKNRAEAAMEFLQELNSDV
1db3A           --SKVALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHY-----GDLSDTSNLTRILREVQPDEVYN
3bywD           -DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLTIAISATEDETTAG--IEGDDSTTETV
3d5tA           -----VAVTGAAGQIAYSLLFRIANGDLLGKDQPV--------ILQLLDLAAVKGVVMELDDCAFPLLAG
3c1oA           -----IIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPQLREEFRSMGVTIIEGEMEEHEKMVSVLKQV
3bywA           -DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHAQLPADATIAISATEDETTA--GIEGDDSTTETV


                         .         .         *         .         .         .         .:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
2d1yB           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVGLFAEQENAAY
3czrA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2d1yA           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLAEQENAAY
1dohB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2ae1A           LNILVNNGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGALAVPYEAVY
1a27A           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGLMGLPFNDVY
1dfiA           DGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKSMLNPGSALLTLSYLGAEAIPNYNVM
2belC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2cfcA           VNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSY
3d3eA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d5qC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3bmoB           FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLIVNLCDAMVDQPMAFSLY
3bzuB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2ag5A           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
3ch6E           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ch6B           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2d1yC           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAQENAAY
2d1yD           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLAEQENAAY
2a4kA           HGVAHFAGVAHSAL----PLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGL--GAFGLAHY
1a9zA           HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDNPKIPYVESFTGTPQSPF
3deyX           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLGLPFNDVY
2belA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ctmF           DVFVANAGVTWTQG-------PENKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISIVNIPQLQAP
3d3wA           DLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQSQAVTNHSVY
2b35E           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPSIVGMDDPSRAMPAYNWM
3d5qD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1dj2A           EPYITDTVHFINDSI-----SQKKKVLVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIASVVGDLI
1edoA           DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLGNIGQANY
2b35A           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPSIVGMDFDPSRMPAYNWM
2b4qB           DILVNNAGTSPVSGWEKVM----QLNVTSVFSCIQQLLPLLRRSASAENPARVINIGSVAGISAMGEQAY
3ce6B           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATIAQIELWTKN
3ek2B           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKPMLSDDASLLTLSYLGAERAIPNYNM
3ctmH           DVFVANAGVTWTQG-------PEIKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSIKIVNIPQLQAP
3ek2A           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDLLTLSYLGAERAPNYNTM
3e03C           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPSLNPAWGAHT
2belD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2ag5B           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSGVVNRCVY
3dwfB           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
2dknA           AVNYFGVSALLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
3edmB           HGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGPGALAY
2ag5C           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSGVVNRCVY
2ehdA           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGLAGKNPFKGGAAY
1d7oA           DILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSSHFLPIMN-PGGASISLTYIASERIPGYGGGM
3e03B           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPSLNPAWWGAHT
2cnbB           DAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEIDINAKKSPE
1dhrA           AILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLK-EGGLLTLAGAKAALDGTPGMIGY
3csdB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGGKQGVHAAPY
2e6hB           RAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHSGTVA-AAKQGYLFGLS
2e6gK           RAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHSGTVAAAKQG-YLFGLS
1cwuA           DILVHSLGNGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTASERIIPGYGGGM
3ek2C           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKPMLSDDASLLTLSYGAERAIPNYNTM
3e9qA           DGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFLT--QALLPLLLKSDAGSLVFTSSSVRQGRANWGAY
3ek2D           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDLLTLSYLGAEAIPNYNTM
3d7lA           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLND--KGSFTLTTGIEDP----IVQG
2ekpA           -VLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSFTAGGPVPIPAY
3bmeC           FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLIVNLCDAMVDQPMAFSLY
2e6cC           RAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHSGTVAAAKQLFGLS
3d4nD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d5qB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2dfdA           DCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSKHGVYNPNKIF
1c3vA           HAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHPHKADAPS
2eghA           EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQL
2b36B           DGVVHSIGFMPQTGNPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWM
3dijA           DVLVNNACG-SKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAY
3diiA           DVLVNNACG-SKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAY
3ch6A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2b35C           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMNWM
3dwfA           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAKITYPLIAPY
1bmdA           YALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAKNAPGLNPRNFT
3ce6A           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATIAQIELWTKN
2a4kB           HGVAHFAGVAWEKVL------------RVNLTGSFLVARKAGEVLE------------------EGGSLV
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
3d4nC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3dwfC           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAKITYPLIAPY
2aqkA           DGVVHAIGFMPQTGMGINPFFDAPYVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSAMPAYNWM
3ch6D           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2aw5C           TALIGVAAIGGEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPYVFPGVALGVV
1c14A           DGFVHSIGFAPGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN--PGSALLTLSYLGAERAINYNVM
2b37C           VVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNM
3e03A           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPSLNPAWWGAHT
3d4nB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3byzA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3c6cA           --------------------------------------------LEVFSPGDILFGKQGLIDGVPLFQVL
1ahhA           DILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITMAAENKNINMTSY
3d7lD           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLN--DKGSFTLTTG----IEDPIVQG
1bhsA           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGVGGLMGLPFNDVY
3edmA           HGLVHVAGGLIRKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
3bhmA           DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSSIMSVALKSCSPE
2bgkA           DIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKHAARMIPAKKGSIVFTASISSFTAGGVSHVY
3ce6D           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATIAQIELWTKN
3bzuA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2aw5B           TALIGVAAIGGEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFPVTLPNGQTL
2aqiA           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVFDPSRAMPAYNWM
3ctmG           FGTIDVFVANAGVTWTVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISG-KIQLQAPY
2ehdB           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSAGKNPFKGGAAY
3bzuD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2aq8A           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALMNPGGSIVGMDFDPSRAMPAYNWM
2dknB           VVAVNYFGVSALLDAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
2e6hD           RAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLHEIWHSGTAAAKQGYLFGLS
2b35D           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVFDPSRAMPAYNWM
2ekqD           HVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFGPVPIPAY
2cnbC           DAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEPIINAKKSPE
2ae2A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGAAVPYEAVY
2belB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2b35B           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPIVGMDFDPSRAMPAYNWM
3d3eB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1bxkB           DCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYHSTDDFF
3ctmA           DVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHN-IGKIFKKNGKGSLIITSSISGKIVQLQAP
3d3uA           NGKKKTLHPEKVVTSLIFGSKELYDFVNNNPVIECYPVDYINNPDVIGKNDRMVSILEMDLMGQAGQVDF
3cq0B           DAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMFYKAYT
2cnbA           HMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTNAEPIDINAKKSPESY
3ctmB           KDFGTIDVFVANAGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIVNLQAPY
2c07A           DILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVLTGNVGQANY
2bfaA           DVLVNNASSFYPTPLLRDRETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3d7lB           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLN--DKGSFTLTTG--IEDPIVQGAS
2aqhA           DGVVHSIGFMPQTGMGINPFFDAPYASKGIHISAYSYASMAKALLPIMNPGGSIVGMFDPSRAMPAYNWM
2b4qA           DILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPARVINIGAMGEQAYAY
1a9yA           HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESFTGTPQSPF
3d4nA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ctmE           DVFVANAGVTWTDNY-----DSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSS-ISGKIQLQAPY
3cxtA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICMMSELGRETVSAY
1e3sA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTAQVGQAAY
1ae1A           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSAGFSALPSVSLY
2bd0A           DCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAATAFRHSSIY
2e37D           QLLDRNAQVFAQVVPRVLEAAPLVATNPVDVTQVAYRLSGLPPGRVVGSGTILDTARFRALLAEYLRVAP
2b35F           NKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGRAMPAYNWM
1e3wA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTGQVGQAAY
1cydA           DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVATFPNLITY
1ae1B           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFALPSVSLY
1a4uA           TVDILINGAGILDDHQIERTIAINFTGLVNTTTAIL--DFWDKRKGGPGGIIANICSVTGFNAIHQVPVY
3d5qA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2bf7A           VNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAAKHRGTNYSIINMVDAMTNQPLLGYTIY
2b37B           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPIVGMDFDPSRAMPAYNWM
1bdbA           NAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
2a92C           ADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDEHSGVPKNKIIG
3ctmD           ISQQEKDFGTIDVGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSKIVNIPQLQAPY
3bmnD           LVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDPCMAFSLY
3c2qA           QCIKNNIPYVLAGSIRD---DGPIPDVITDSVAQDKRTTVDKKVIL-----------STLLHSVATGNLP
3cxrA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSEGRETVSAY
1e6wB           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAAAY
2bfmB           DVLVNNASSFYPTPLLRNMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
1e7wB           DVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSPLLGYTIY
2dteA           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASITKNASAY
2bfpB           DVLVNNASSFYPTPLLGDMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
2bfoA           DVLVNNASSFYPTPLLRGDREAMETATADNAIAPYFLIKAFAHRVAGTPAKHRGTNYSMTNQPLLGYTIY
2e6bC           HAPHFPAYRVRGTPADCVALGLHLFGPVDLV---------LSGVNLGSNLGHEIWHSGTAAKQGYLFGLS
3e48A           IHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLLSTSGIDYTYRAYDPLKPY
1b8pA           DVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPNTNAYIAKSAPSLPAKNFT
3bmqA           LVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
1e92A           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
1c9yA           NVLITDTWISMGREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLV---F
2aw5A           TALIGVAAIGGAFSEQILKDMAAFNERPALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPTLPNGQTL
2bf7B           VLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSITNQPLLGYTIY
1e6wC           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVAAFEGQVGQAAY
2e6cD           HAPHFPAYRVRGTP---ADCVALGLHLFGPVDLV-----LSGVNLGSNLGHEIWHSGTVAAKQGYLFGLS
2c7vD           DVLVNNASAFYPTPLVQGDHNGKTVETQVAELIGTNAIMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3bmfB           FGRCDVLVNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
2bfaD           DVLVNNASSFYPTPLLRDRETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3bzuC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3edmD           HGLVHVAGGIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
3e9qB           DGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFLTQA--LLPLLLKSDAGSLVFTSSSVGRGRANWGAY
2c7vB           DVLVNNASAFYPTPLVQNGKTVETELIGTNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPMAFSLY
2bfaB           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3c2qB           QCIKNNIPYVLAGSIRDDGP---IPDVITDSVAQDKRTTVDKKVIL-----------STLLHSVATGNLP
1e6wD           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTGQVGQAAY
2e6bD           HAPHFPAYRVRGTPADCVALGLHLFGP---------VDLVLSGVNLGSNLGHEIWHSGTAAKQGYLFGLS
3bmnB           DVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDVDQPCMAFSLY
3edmC           HGLVHVAGGLIARTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
1e6wA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTGQVGQAAY
3ctmC           ISGTIDVFVANAGVTWVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIQLAPYNT
1bdmA           DPDVAFKDADYALLVGAAPLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAKNAPGLNPRNFT
2e37E           QLLDRNAQVF--AQVVPRVLEAAPEAVLLNPVDVTQVAYRLSGLPPGRVVGSILDTARRALLAEYLRVAP
3bmnC           DVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDPCMAFSLY
2axqA           DVVISLIPYTFHPNVVKSAIRTKTDVVTSSYISPALRELE----PEIVKAGITVMNEIGLDPGIDHLYAV
1e92B           DVLVNNASSFYPTPLLRREAMETADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
1di6A           HLVLTTGGTGPARR--DVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQAL--ILNLP
2e6hC           SPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGH----EIWHSGTVAAAKQGYLFGLS
1e7wA           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYAMTNQPLLGYTIY
3dhnA           SLDEVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLVGGAGSLFIAPGLRLDGEVPENIL
1c9kB           ILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGI---VPE
1dj3A           FAERLEPFIADTVHVLNESIRQKKKILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTLGIAPRVIGDLI
2c7vA           FGRCDVLVNNASAFYPTPLVQGKAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3bmfC           GRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
2e37B           QLLDRNAQVF--AQVVPRVLEAAPEAVLLNPVDVTQVAYRLSGLPPGRVVGSGTILDARFRALLAEYLRV
3bmdB           GRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDPCMAFSLY
3d64A           NAIVCNIGHFDSEI---DVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHQTLAQIEL
3bmoA           FGRCDSAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVDAMVDQPCMAFSLY
3bmiB           CDVLVNNASAFYPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQS--SNLSIVNLCDAMVDPCMAFSLY
3bmqC           DVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDPCMAFSLY
1e92D           APVTLFSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
2bfoC           DVLVNNASSFYPTPLLRDREAATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3bmfD           CDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS-IVNLCDAMVDQPMAFSLY
3dxfB           KLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYFRDIGVPMTSVRLPCYFELLSHFLP
1bsvA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGLEPTNEPY
3e6vA           SWVTPCISAKDIVYIGLRDVNPILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHATGTPVVG
1e7qA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESLLQGTLEPTNEPY
2c7vC           DVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNIVNLCDAMVDQPMAFSLY
3bmoD           FVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSNLSIVNLCDAMVDPCMAFSLY
1bxkA           DCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISVYGDLHSTDDFF
2c5aB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAF
2a92B           IVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDQLLFEHSGVPKNKIIG
3bmeA           FGRCDVLVNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNSIVNLCDAMVDQPMAFSLY
1e92C           DVLVNNASSFYPTPLLRNDREAMEDLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3bmfA           CFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIMSFAQRQSNLSIVNLCDAMVDPCMAFSLY
3bmjD           FGRCDVLSAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQS---NLSIVNLCDAMVDQPMAFSLY
2bllA           AIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGKPRWIY
2bfpD           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
3d7lF           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLN--DKGSFTLTTG----IEDPIVQG
3dfzA           DQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECVLIHRLNVSK
3bmkC           FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKNIVNLCDAMVDPCMAFSLY
1c9kA           PDDAILLECITTMVTNLLFALDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNVGMGIVPENRLA
2bfmC           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
2c29F           DFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCSDMEFCRAKKMT
3c3xA           DVVISALAVPQYLDQFKILE------------------AIKVAGNIKRFLPSDFGVEEDRINALPPFEAL
1d4fA           DAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEGRLVNLGCAMGHPSFVMSNSF
2bfaC           DVLVNNASSFYPTPLLRREAMATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
2bkaA           DVGFCCLGTTR------------GKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLY
1d4gA           DAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSF
3bmnA           DVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLY
2c82A           TRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLVLRAARPEHSALAQCLRGGTP
2bf7C           DVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDLGYTIY
1b3rA           DAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEGRLVNLGCAMGHPSFVMSNSF
1bdmB           VAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAK--KDVKVLVVGNPANTGLNPRNFT
3e9nA           VDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHAL---
3dxfA           YATFIVTNYWECSQEQ-------EVKQGKLLA-------DLARRLGLHYVVYSGLENIKKLTAGRLAAAH
2c5eB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3bmeB           FGRCDVLVNNASAPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMG
2c59B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3e5mA           FIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVE--------
1e7sA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELQGTLEPTNEPY
2c54A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3bmoC           DVLVNNASAFYPTPLVQGKTVQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLY
2e37C           QLLDRNAQV--FAQVVPRVLEAAPEAVLLNPVDVTQVAYRLSGLPPGRVVGSGTILDTARFRALLSVHAY
2e6gA           FPAYRVRGTPADCVALGLH---LFGPVDLVLSGVN---------LGSNLGHEIWHSGTVAAKQGYLFGLS
2bf7D           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAGYTIY
2a35A           LGTTIKEAGSEEAFRAVDFDLPLA----------------VGKRALEMGARHYLVVSALGADA-KSSIFY
2e6gJ           --------------------------------------------LGSNLGHEIWHSGTVAAKQGYLFGLS
2c59A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
2c54B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
1ek5A           MAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGY
3e9nB           DKLKNLDHVDTLVHAASVAEW--HAHLDLNVIVPAELSRQLLPALRAA----------SGCVIYINNTIY
1di7A           HLVLTTGGTGPARR--DVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSIRKQALILNLGQPKSIKE
2e37A           QLLDRNAQVFAQ--VVPRVLEAAPEAVLLNPVDVTQVAYRLSGLPPGRVVGSGTILDTARFLAEYLRVAP
1cg3A           MAVILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLPRYVDYVL
3e5mB           FIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENI----------------KKLTAGRLAAAH
2c5eA           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3e8xA           DAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFIVSSVG------------------TVDPD
3e9nC           VDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYIN----------NTIY
1cbuC           ILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGI---VPE
3d3jA           DLVINCLDCPENVF--LRDQPWYKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLEHAGRIYLCD
3e9nE           LDHVDTLVHAAGSVAEWHAHLDLN---------------VIVPAELSRQLLPALRAASGCVIYINGNTIY
2e6eB           FPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLAAAKQGYLFGLSA----AAFSVPLE--VPDFA-----
1bwsA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLGTLEPTNEPY
2e6eD           DCVALGLHLFGPVDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVPDLRTLETLLRLERPFLVNVNRPKGF
2c20A           MHFAADSLVGVSMEKPLQYYNNNVYGALCLLEVMDEFKVDKFIFSSTAATYGEVDVDLITEETMTNTNTY
3dtdB           SGLVSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALR-AGKHLKLAMTIAAPG----EPPL
1a7aB           AIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILL---AEGRLVNLGCAGHPSFVSNSF
2a92A           IVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSKNKIIG
3dqpA           DVDWTPEEAKQLHGDAIINVSGSGGKSLLKVDLYGAVKLQAAEKAEVKRFILLSTIFSL-QPEKWIGAGF
2cukA           GAILLNTARGALVDTEALVEALRGHLFGAGLDV-----TDPEPLPPGHPLYALPNAVITPHI----GSAG
3e9nH           KLKNLDHVDTLVHAASVAEWHAHLDLN------------VIVPAELSRQLLPALRAASGCVIYINGNTIY
3e9nF           DKLKNLDHVDTLVHAASVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINGNTIYAAS--------
1edzA           DVVITGVPSENYKFP-TEYIKEGAVCINFACTKNFSDDVKEKASL-------YVPMTGKV----------
3e9nD           DKLKNLDHVDTLVH--AASVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHAL---
1bw3A           DLDWDTVFTKIDT----NGIGYQQGHLNVNYQF-------------------------------------
2eezA           LKLVTRDMLSLMKEGAVIVDVAYV------VDGVVHYGVANMPGAVPRTSTFALTNQTLPVLKLAEKKGL
3dfzB           DQLVNMASSFSDGNIQIPAQFSRGRAISTDGASPLLTKREDLSSNYDESYTQYTQFLYEC--RVLIHRLN
1a4iA           AYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKR---------------------------------
3donA           ESHLDEFDIIINTTPDSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHGAESFKIW
3d5tC           VAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQGAALNEVASRDVANTNAYIAMKSAPDLPKKNFT
1e6uA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESLLQGTLEPTNEPY
1civA           EWALLIGAKPRGPGMERADLLDINGQIFAEQKALNAVASPNVKVMVVGNPCNTNALILKNAPNIPPKNFH
2c5aA           GMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESAWPAEPQDAF
1buaB           -------------------------LYDEDVCGIISAGKIYPLGSDTKVLSTIFELFSRIINKIAEKHGY
3dooA           -----------------VISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQAESFKIW
3bywF           RDVRPIIGILESNAAADLLNAGLNAHVEINSR--------------------------------------
3bywB           RDVRPIIGILESNAAADLLNAGLNAHVEINSR--------------------------------------
2e6gG           FPAYRVRGTPADCVALGLH---LFGPVDLVLSGV----------NLGSNLGHEIWHSG--TVAAAKQGYL
1cg4A           VSDLLDQARQRGDFV-------MFEGAQGTLLDIDHGTYPYVTSSN----TTAGGVATGSLGPRYVDYVL
3eheA           HIAANPDVRGAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTS-TVYGEAKVIPTPEDYPTHPISLY
1a7aA           AIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGHPSFVSNSFTNQVQIELWTHP
2a35B           ELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSAL-GADAKSSIFY
2eggA           ------------------------------------PLETKWLKEAKARGARVQNGVGMLVYGALAFEKW
1cg1A           TSMVVDVSDLLDQARQRG-----DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSLGPRYVDYVL
1a4iB           NYVPDDKKPNGR-----------KVVGDVAYDEAKERASFITPVPG----GVGPMTVA-----MLMQSTV
3bywC           IGIYTELESNAAADLLNAGLNA--HV-EIN----------------------------------------
1ddtA           ----------------------------------------------------------------------
1d0iA           CGIVINPAHTSVAILDALNTCDGLPVVEVHISNIHQREPFR---------HHSYVSQRDGVVAGCGVQGY
3e48B           IHPSFKRIPEVENL--------------------------------------------------------
1adeA           VSDLLDQARQRGDF-----------VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSLGPRYVDYVL
2e6gB           FPAYRVRGTPADCVALGLH---LFGPVDLVLSGVN---------LGSNLGHEIWHSGTVAAKQGYLFGLS
2dt8A           LSLHISGKLSGTQSAELAAQEFPGRVTVVDTQAASLGVGVLRAKELLEEELERLRRDHFVRFSVAT-LEF
2ef0A           GFQVNGELLKLLRPGEETTEEAVHGPRSRVFDQALHTAKAVLLTL-------------------------
3bywH           ERDVRPIGILESNAAADLLNAGLNAHVEINSR--------------------------------------
3dbrG           SGSFVEESPENL----LDNDPSFFCRFTVVVATQLPETSLRLADVLWNSQIPLLICRTYGLVG-------
1db3A           LGAMSHVAVSFESPEYTADVDAMGTLRLLEAFLGLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPY
3bywD           ERDVRPII--------------------------------------------------------------
3d5tA           VVITDDPKVAFKDADVALLVGARPRSRKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAKSAP
3c1oA           DIVISALPFPMISSQIHIAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAI---------
3bywA           ERDVRPIGILESNAAADLLNAGLNHV-EINSR--------------------------------------


                         +         .         .         .         .         *         .:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
2d1yB           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIRT----RRDWEDLHALRRLGKPEEVAEA
3czrA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVHMQAAPKEECALEIIKGGALRQEEVYYW
2d1yA           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIA-----RRDWEDLHALRRLGKPEEVAEA
1dohB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCRNEEVDEYAAVQWSPLRRVGLPIDIARV
2ae1A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQKENL-----NKLIDRCALRRMGEPKELAAM
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEQYLAHSKQVFREAAQNPEEVAEV
1dfiA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLMLAHCEA-----------VTPIRRTVTIEDVGNS
2belC           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGMQAAPKECALEIIKGGALRQEEVYYD
2cfcA           TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQW-RLDQPELRDQVLARIPQKEIGTAAQVADA
3d3eA           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAAVSGIVQAAPKEECALEIIKGGALRQEEVYYW
3d5qC           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVQ-AAPKEECALEIIKGGALRQEEVYSLW
3bmoB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEE----KDKWRRKVPLGRREASAEQIADA
3bzuB           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
2ag5A           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARLKRQKTGRFATAEEIAML
3ch6E           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
3ch6B           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
2d1yC           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPERDWEDLHALRRLGKPEEVAEA
2d1yD           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIAT----RRDWEDLHALRRLGKPEEVAEA
2a4kA           AAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPW---AWEQEVGASPLGRAGRPEEVAQA
1a9zA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGED-PQGIPNNLMPYIAQVAVGRRDSLAIF
3deyX           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTEVLDRTDIHTFHRFYQYLKQVFREAAQNPEEVAEV
2belA           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSMQAAPKEECALEIIKGGALRQEEVYYD
3ctmF           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKD---MKAKWWQLTPLGREGLTQELVGG
3d3wA           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
2b35E           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAGAQIQLLEE----GWDQRAPIGWNMKDATPVAKT
3d5qD           SASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSMQAAPKEECALEIIKGGALRQEEVYYD
1dj2A           GVVKAYTTRVGSGPFPTENLGLLRLAGQEFGTTTGRPRRCGWLDIVALKFASLNLTKLDVLSDLNEIQLG
1edoA           AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGED---MEKKILGTIPLGRTGQPENVAGL
2b35A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGAQIQLLE-----EGWDQRAPIGWNMKDATPVAKT
2b4qB           GPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQ-ALEADSASIPMGRWGRPEEMAAL
3ce6B           DEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLG-------------VDVEGPYKPDHYR--
3ek2B           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKFGKILDFVES----------NSPLKRNVTIEQVGNA
3ctmH           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
3ek2A           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPISGIKSFGKIL------DFVESNSPLKRNVTIEQVGNA
3e03C           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDAINLP-------------GVDAAACRRPEIADA
2belD           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMALEIIKGGALRQEEVYYDSSLW
2ag5B           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFQKTGRFATAEEIAML
3dwfB           SASKFALDGFFSTLRSEFLVNKVNITLCILGLIDTETAIKATSGIYLGPASPIKGTALRQDEMYYVGSRW
2dknA           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQASKADPRYGESTRRFVAPLGRGSEPREVAEA
3edmB           ATSKGAVMTFTRGLAKEVGP-KIRVNAVCPGM-----------------------ISTTREGSSEDVAGL
2ag5C           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEDFLKRQKTGRFATAEEIAML
2ehdA           NASKFGLLGLAGAAMLDLREANVRVVNVLPGLKPEDVAQAVLFALEMPGHAMVSEIEL------------
1d7oA           SSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNA
3e03B           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDAINLPGV-------------DAAACRRPEIADA
2cnbB           SPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEHYQGSTHILGRVMSDIADKRMPIFGT
1dhrA           GMAKGAVHQLCQSLAGKNMPSGAAAIAVLPVTLDTPMNRKSMPE-----------ADFSSWTPLEFLVET
3csdB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
2e6hB           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2e6gK           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
1cwuA           SSAKAALESDTRVLAFEARKQNIRVNTISAGPLGSRAAKAIGFIDT-MIEYSYNNAPIQKTLTADEVGNA
3ek2C           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSFGKILDFV--------ESNSPLKRNVTIEQVGNA
3e9qA           AASKFATEGQV---LADEYQQRLRVNCINPGGTRTARASAFPTE------------DPQKLKTPADIPL-
3ek2D           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKSFGKILDFVE---------SNSPLKRNVTIEQVGNA
3d7lA           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKL---------------EPFFEGFLPVPAAKV
2ekpA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPI-TARIPMGRWARPEEIARV
3bmeC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVP------------LGRREASAEQIADA
2e6cC           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3d4nD           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSMQAAPKEECALEIIKGGALRQEEVYYD
3d5qB           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
2dfdA           GVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQC--TPKVDFPQDQLTALTGRIQEAGT
1c3vA           GTAARTAKLIAEARKGLPPNPDATSTSLPGARGADLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLA
2eghA           LPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGR
2b36B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQIQLLEEGWDQRAPIGNMKDATPVAKT
3dijA           ASAKGGIVALTH-ALAMSLGPDVLVNCIAPGWINVTFTQEDCAA-----------IPAGKVGTPKDISNM
3diiA           ASAKGGIVALTH-ALAMSLGPDVLVNCIAPGWINVTEFTQEDC----------AAIPAGKVGTPKDISNM
3ch6A           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
2b35C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLLEEGWDQRA----------PIGWNMKDATPVAKT
3dwfA           SASKFALDGFFSTLRSEFLKVNVSITLCILGLIDTETAIKAT-----------SGIYLGPASPKEECALE
1bmdA           AMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDL------FHAEVDGRPALELVDMEWYEKV
3ce6A           DEYDNEVYRLPKHLDEKVAR----IHVEALGGHLTKLTKEQAEY---------LGVDVEGPYKPDHYR--
2a4kB           LTGKLGVVGLARTLALELARKGVRVNVLLPGLIQAWEQEVGA-------------SPLGRAGRPEEVAQA
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNEYAAVQWSPLRRVGLPIDIARV
3d4nC           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSMQAAPKEECALEIIKGGALRQEEVYYD
3dwfC           SASKFALDGFFSTLRSEFLKVNVSITLCILGLIDTETAIKATS-----------GIYLGPASPKEECALE
2aqkA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEGWDQRAPIGWNMKDATPVAKT
3ch6D           SASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
2aw5C           ACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNK
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHC-EAVTPIRRTVTIEDVGNS
2b37C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGEEAGIQLLEEGWDQRAPIGWNMKDATPVAKT
3e03A           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIAT-------------------GVDAAACRRPEIADA
3d4nB           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3byzA           SASKFALDGFFSSIRKEYSVSRVNVSICVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3c6cA           GVLWGAPASTETIYQRNLIPANAQWAAFGIGRDQPAQAALLGGNVRVGLEDNLYLSRGVFATNGQLVER-
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPE--IEQKMLQHTPIRRLGQPQDIANA
3d7lD           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKLE---------------PFFEGFLPVPAAKV
1bhsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEQYLAHSKQVFREAAQNPEEVAEV
3edmA           ATSKGAVMTFTRGLAKEVGP-KIRVNAVCPGMIST------------------------REGSSEDVAGL
3bhmA           LQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSRTDMAGPKATKSEGAETPVYLALLPPDAEGP
2bgkA           TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRELAHQAANLKGTLLRAEDVADA
3ce6D           DEYDNEVYRLPK----HLDEKVARIHVEALGGHLTKLTKEQAE---------YLGVDVEPY-KPDHYR--
3bzuA           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
2aw5B           YPGQGNNSYVFPGVALGV--VACGLRQITDNIFLTTAEVIAQQVSDKHEEGRLYPPLNTIRDVSLKIAEK
2aqiA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGIQLLEEGWDQRAPIGWNMKDATPVAKT
3ctmG           NTAKAA-CTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKD---MKAKWWQLTPLGREGLTQELVGG
2ehdB           NASKFGLLGLAGAAMLDLREANVRVVNVLPGSVKLKPED--------VAQAVLFALEMPGHAMVSEIEL-
3bzuD           SASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
2aq8A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGIQLLEEGWDQRAPIGWNMKDATPVAKT
2dknB           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPGV-----------------------APLGRGSEPREVAEA
2e6hD           AAAFSVPLGEVPDFALRLERVNVNLPLRPKGFLWTRQSVRAYEGVVIPDPMGRPFYWFAPRPLKEAEEGT
2b35D           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEGWDQR----------APIGWNMKDATPVAKT
2ekqD           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYEPITAR-----------IPMGRWARPEEIARV
2cnbC           SPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIG---------------------------
2ae2A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKLNKLIDRCALRRMGEPKELAAM
2belB           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAAPIKGGALRQEEVYYDSSLW
2b35B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEEGWDQRAP------------IGWNMKDATPVAKT
3d3eB           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSVQAAPKEECALEIIKGGALRQEEVYYD
1bxkB           TETTASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILPVYGNGQQIRDWLYVEDHARA
3ctmA           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKD---MKAKWWQLTPLGREGLTQELVGG
3d3uA           LRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTGRNEVDYVV--------TEYGVARLRGATLRQRAEA
3cq0B           AETDPGVLSVKKIYS-YYKRHGYATEVMAASFRNLDELKALAGIDNMTLQLYESTDPIENKLNSESAGVE
2cnbA           GESKLIAERMIRDCAEA---YGIKGICLRYFNAC---GAHEDGDIGEHYQGSTHLIPIILGRVMSDIAPD
3ctmB           NTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQL----TPLGREGLTQELVGG
2c07A           SSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKK--------NIISNIPAGRMGTPEEVANL
2bfaA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
3d7lB           AAANGAVTAFA--KSAAIEPRGIRINTVSPNVLEESWDKL---------------EPFFEGFLPVPAAKV
2aqhA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEGWDQRAPIGWNMKDATPVAKT
2b4qA           GPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIAN-DPQALEADSASIPMGRWGRPEEMAAL
1a9yA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNN-LMPYIAQVAVGRRDSLAIF
3d4nA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVHMQAAPKEECALEIIKGGALRQEEVYYW
3ctmE           NTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDM----KAKWWQLTPLGREGLTQELVGG
3cxtA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTHPFDQ-------FIIAKTPAARWGEAEDLMGP
1e3sA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQV----------------PFPSRLGDPAEYAHL
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQKEEIDNFI----------VKTPMGRAGKPQEVSAL
2bd0A           CMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGKVDDE------------MQALMMMPEDIAAP
2e37D           QSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARALSP-------EDRARIDEGVRRAAYRIIEGKGA
2b35F           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQIQLLEEG-------WDQRAPIGWNMKDATPVAKT
1e3wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTVRN------FLASQVPFPSRLGDPAEYAHL
1cydA           SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPE-FARKLKERHPLRKFAEVEDVVNS
1ae1B           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIIVKTPMGRAGKPQEVSAL
1a4uA           SASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRV--AELLLSHPTQTSEQCGQ
3d5qA           SASKFALDGFFSSIRKEYSVSRVNVSICVLGLIDTETAMKAVMQAAPKEE-CALEIIKGGALRQEEVYYD
2bf7A           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKV----PLYQRDSSAAEVSDV
2b37B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPI-------------GWNMKDATPVAKT
1bdbA           TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDLRGPSSL--GPLADMLKSVLPIGRMPEVEEYTGA
2a92C           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYI---TVGGIPLQEFINNKKITDEEVEG
3ctmD           NTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDITDFASKD---MKAKWWQLTPLGREGLTQELVGG
3bmnD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3c2qA           SYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVGV------------------------------------
3cxrA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHP-FDQFIIAKTPAARWGEAEDLMGP
1e6wB           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTFLAS----------QVPFPSRLGDPAEYAHL
2bfmB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
1e7wB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDWEGHRSKV----------PLYQRDSSAAEVSDV
2dteA           VTSKHAVIGLTKSIALDYAPLLRC-NAVCPATIDTPLVRKAAERIEKKISEWGHEHPMQRIGKPQEVASA
2bfpB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKV----PLYQRDSSAAEVSDV
2bfoA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
2e6bC           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVREGVVIPGEDPMGRPFYWFAPRPLKEAEEGT
3e48A           LPELNHKLIYPAGDGRINYITRNDIARGVIAIIKN-----------------------------------
1b8pA           AMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSP-TMYADYRYAQIDGASVKDMINDDAWNRDTFLPT
3bmqA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
1e92A           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKV----PLYQRDSSAAEVSDV
1c9yA           PEAENRKWTIMAVMVSLLTDYSPQLQKP------------------------------------------
2aw5A           YPGQGNNSYVFPGVA-------LGVVACGLRQITDNIFLTTAEAQQVSDKHLEEGRLYPPLNTIRDVSLK
2bf7B           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKV----PLYQRDSSAAEVSDV
1e6wC           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTNFLAS---------QVPFPSRLGDPAEYAHL
2e6cD           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2c7vD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3bmfB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2bfaD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVHRSKV--------------PLYQRDSSAAEVSDV
3bzuC           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVMQAAPK-EECALEIIKGGALRQEEVYYD
3edmD           ATSKGAVMTFTRGLAKEVGPKIRV--------------------------------NAVCPGSSEDVAGL
3e9qB           AASKFA---TEGQVLADEYQQRLRVNCINPGGTRTARASAFPTE------------DPQKLKTPADI--P
2c7vB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2bfaB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
3c2qB           SYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVGV------------------------------------
1e6wD           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKV--RNFLASQVPFPSRLGDPAEYAHL
2e6bD           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3bmnB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3edmC           ATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSSEDVA--------------------------------GL
1e6wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLA------SQVPFPSRLGDPAEYAHL
3ctmC           AKAACT---HLAKSLAIEWAPFARVNTISPGYIDTDITDFASKD---MKAKWWQLTPLGREGLTQELVGG
1bdmA           AMTRLDHNRAKAQLAKK---TGTGVDRIRRMTVWGNHSSIMFP---DLFHAEVDGRPALELVDMEWYEKV
2e37E           QSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAESPEDRARIDE-----------GVRRAAYRIIEGKGA
3bmnC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2axqA           KTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVL----LALRNSAKYWKDGKIETVSSE
1e92B           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
1di6A           GQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVET---------------------------
2e6hC           AAAFSVPLN---GEVPDFAGVNVNLPLRPKGFLWTRQSVR-AYEGVVIPGEDPMGRPFYWFARPLKEAEE
1e7wA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
3dhnA           PGVKAL----GEFYLNFLKEKEIDWVFFSPAADRPGVRTGRYRLG----KDDIVDIVGNSHISVEDYAAA
1c9kB           NRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVK-----------------------------------
1dj3A           GVVKAYTTRVGSGPFPTELDVLRKAGMEFGTTTGRPRRCGWLDIVALKGFSSLNLTKLDVLSGLPEIKLG
2c7vA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3bmfC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLGEEEKDKWRR---------KVPLGRREASAEQIADA
2e37B           APQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALS---PEDRARIDEGVRRAAYRIIEGKGA
3bmdB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEK-----DKWRRKVPLGRREASAEQIADA
3d64A           FTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAA-YIGVSKAGPFKPDHYR----------
3bmoA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3bmiB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3bmqC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
1e92D           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2bfoC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDGHRSKVP------------LYQRDSSAAEVSDV
3bmfD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3dxfB           QKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKMPEKYVG--------QNIGLSTCRHTAEEYAAL
1bsvA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGP-HDNFHPSNSHVIPALLRRFHEATAQNAPDV---
3e6vA           GLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTV-------NTAVAITLACFGLAREGNHK
1e7qA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGP-HDNFHPSNSHVIPALLRRFHEATAQSAPDV---
2c7vC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
3bmoD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
1bxkA           TETTASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNVYGNGQQIRDWLYVEDHARA
2c5aB           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPF---GTWKGGREKAPAAFCRKAQTSTDRFEM---
2a92B           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYI---TVGGIPLQEFINNKKITDEEVEG
3bmeA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
1e92C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
3bmfA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEK-----DKWRRKVPLGRREASAEQIADA
3bmjD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2bllA           SVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARILVEGSPIKLDGGKQKRCFTDIRDGIEA
2bfpD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
3d7lF           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKLEP---------------FFEGFLPVPAAKV
3dfzA           SRKHELLTEIIDDQRLSLVKQREFLQQIEK----------------------------------------
3bmkC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
1c9kA           RHFRDIAGR----VNQRLAAAADEVWLVVSGIGVK-----------------------------------
2bfmC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2c29F           AWMYFVSKTLAEQAWKYAKENNIDFITIIPT---------------------------------------
3c3xA           IERKRMIRRAIEEANIP--YTYVSANCFASYFINYLLRPYDPKD---EITVYGTGEAKFAMNYEQDIGLY
1d4fA           TNQPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ---------YLGMPINGPFKPDHYR--
2bfaC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVRSKVPL---------------YQRDSSAAEVSDV
2bkaA           LQVKGEVEAKVEEL------KFDRYSVFRPGVLLCDRQESRPGEWLVRKGSLPDSWASGHSVPVVTVVRA
1d4gA           TTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ---------YLGMPINGPFKPDHYR--
3bmnA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2c82A           DEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSGLEVIETHLLFGIPYDRIDVVVH
2bf7C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
1b3rA           TNQVDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ---------YLGMPINGPFKPDHYR--
1bdmB           AMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMFPDLF------HAEVDGRPALELVDMEWYEKV
3e9nA           -------RGLADAFRKEEANNGIRVSTVSPGPTRPEIY-----------------------IEPKEIANA
3dxfA           FDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGK---SYLLSLPTGDVPMDGMSVSDLGPV
2c5eB           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPF---GTWKGGREAAPAAFCRKAQTSTDRFEMW--
3bmeB           KHAL---VGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2c59B           GLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREK---------------------------
3e5mA           --------EYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKS---YLLSLPTGDVPMDGMSVSDLGPV
1e7sA           AIARIAGIKLCESYN---RQYGRDYRSVMPTNLYGP-HDNFHPSNSHVIPALLRRFHEATAQSAPDV---
2c54A           GLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKWGDGLQTRSFTFIDECVEG
3bmoC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD----KWRRKVPLGRREASAEQIADA
2e37C           VLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALSPEDRARIDE---GVRRAAYRIIEGKGATYYGIGAG
2e6gA           AAAFSVPGEVPDFAGLRLERVNVNLPLRPKGFLWTRQSVRAYVVIPGEDPMGRPFYWFAPRPLKEAEEGT
2bf7D           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVRSKVPL---------------YQRDSSAAEVSDV
2a35A           NRVKGELEQALQEQ------GWPQLTIARPSLLFGPREEFRLA----------EILAAPIAGKYHGEGKG
2e6gJ           AAAFSVPLN---GEVPDFAGVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2c59A           GLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREK---------------------------
2c54B           GLERLATEELCKHYNKD---FGIECRIGRFHNIYGPFG--------------------------------
1ek5A           GKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGC-IGEDPQGIPNNLMPYVSQVAIGRREALNVF
3e9nB           AASKHALRGLADAFRKEEANNGIRVSTVSPIEPKEIANAIRFVIDAGETTQITNVDVRPRI---------
1di7A           TLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEVVAA----------------------------
2e37A           QSVHAYVLGEEVLVWSSAQVGGVPLLEFAEARALSPEDRARI-----------DEGVRRAAYRIIEGKGA
1cg3A           GILKAYSTRVGAGPFPTELETGEFLCKQGNEGATTGRRRRTGWL---------DTVAVRRAVQLNSLSG-
3e5mB           FDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKS---YLLSLPTGDVPMDGMSVSDLGPV
2c5eA           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGTWKGG---REAAPAAFCRKAQTSTDRFEM---
3e8xA           QGPNRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVT-------VSPHFSEITRSITRHDVAKV
3e9nC           AASKHALRGLADAFRKEEANNGIRVSTVSPGPEPKEIANAIRFVIDAGETTQITNVDVR-----------
1cbuC           NRLARHFRDIAGRVNQRLAAAADEVWLVVSG---------------------------------------
3d3jA           IGIPQQGINYHSPFGCKFV---------------------------------------------------
3e9nE           AASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
2e6eB           -GLRPWLLRTLETL-LRLERVNVNLPLRPKGFLWTRQSVRAYVVIPGEDPMGRPFYWFAPRPLKEAEEGT
1bwsA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDNFHPS---------------------------
2e6eD           LWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKE-----------------------------------
2c20A           GETKLAIEKMLHWYSQA---SNLRYKIFRYFNVAGATPNGIIGEDHRPETHLIPLVLQVALGQREKIMMF
3dtdB           NDLFVQLNGFSNALNRLIALQK------------------------------------------------
1a7aB           TNQVAQIELWTHPLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ----------YLGSCDGPFKPDH----
2a92A           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQ---EFINNKKITDE----
3dqpA           DALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDIN----------DEVSASNTIGDVADT
2cukA           RTTRERMAEVAVENLLAVLEGREPPNPV------------------------------------------
3e9nH           AASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
3e9nF           ---KHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
1edzA           ----------------------------------------------------------------------
3e9nD           -------RGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
1bw3A           ----------------------------------------------------------------------
2eezA           NTHKGRLT--HPGVAEAFGLPYTPPEEALRG---------------------------------------
3dfzB           VSKSRKHELLTEIYRLSLVKQREFLQQIE-----------------------------------------
1a4iA           ----------------------------------------------------------------------
3donA           TNLEPDIKAMKNIVIQKLKGELL-----------------------------------------------
3d5tC           AMLRLDHNRALSQLAAKSGKPVASIEKLAVWGNHSPTM--------------------------------
1e6uA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGP-HDNFHPSNSHVIPALLRRFHEATAQKAPDV---
1civA           ALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHST----------------------------------
2c5aA           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGTWKGG---------------------------
1buaB           IVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKFIRNNTPFDQYIAHWIIGYVYTRSLKTYNINEL
3dooA           TNLEPDIKAMKNIVIQKLK---------------------------------------------------
3bywF           ----------------------------------------------------------------------
3bywB           ----------------------------------------------------------------------
2e6gG           FGLSAAAFSPLNGEVPDFAGVNVNLPLRPKGFLWTRQ-SVRAYEGVVIPGEDPMGRPFYWFAKEAEEGTD
1cg4A           GILKAYSTPFPTELFDETGEF-LCKQGNEFGATTGL-RRRTGWLDTVAVRRA------VQLNSLSGFCLT
3eheA           GASKLACEALIESYC---HTFDMQAWIYRFANVIGRRSTHGVIYNPEELEILGNGEQNKSYIYISDCVDA
1a7aA           DKYPVGVHFLPKKLDEAV----AEAHLGKLNVKLTKLTEK------------------------------
2a35B           NRVKGELEQALQEQG------WPQLTIARPSLL----------FGPREEFRLAEILAAPIPGKYHGIGKG
2eggA           TGQWPDVNRMKQLVIEALRR--------------------------------------------------
1cg1A           GILKAYSTRVGAPFPTELF---------------------------------------------------
1a4iB           ESAKRFL---------------------------------------------------------------
3bywC           ----------------------------------------------------------------------
1ddtA           -----------DSETADNLEKTTAALSILPGIGSVMGIADGAV-HHNTEEIVAQSIALSSLMVAQAIPLV
1d0iA           VFGVERIAA-------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
1adeA           GILKAYSTRVGA----------------------------------------------------------
2e6gB           AAAFSVPLNGLRPWLLRTLEVNVNLPLRPKGFLWTRQ-SVRAYEGVVIPGEDPMGRPFYWFALKEAEEGT
2dt8A           LKRGGRIGGAQAFLGTLLNLKPV-----------------------------------------------
2ef0A           ----------------------------------------------------------------------
3bywH           ----------------------------------------------------------------------
3dbrG           ----------------------------------------------------------------------
1db3A           AVAKLYAYWITVNYRES---YGMYACNGILFNH-------------------------------------
3bywD           ----------------------------------------------------------------------
3d5tA           DLPKKNFTAMLRLDHNRALS-----QLAAKSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLK---
3c1oA           ----------------------------------------------------------------------
3bywA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAFLLSNEASFITGQVICVDGGGSL
2d1yB           VLFLASEKASFITGAILPVDGG---
3czrA           TTLLIRNPSRKILEFLYSTSY----
2d1yA           VLFLASEKASFITGAILPVDGG---
1dohB           VCFLASNDGGWVTGKVIGIDGGACM
2ae1A           VAFLCFPAASYVTGQIIYVDGG---
1a27A           FLTALRAPLRYFTTERFDDPSGSNY
1dfiA           AAFLCSDLSAGISGEVVHVDGG---
2belC           SSLWTTLLIR---------------
2cfcA           VMFLAGEDATYVNGAALVMDGA---
3d3eA           TTLLIRNPSRKILEFLYST------
3d5qC           TTLLIRNPSRKILEFLY--------
3bmoB           VIFLVSGSAQYITGSIIKVDGGLSL
3bzuB           TTLLIRNPSRKILEFLYST------
2ag5A           CVYLASDESAYVTGNPVIIDGGWSL
3ch6E           TTLLIRNPCRKILEELYSTSYN---
3ch6B           TTLLIRNPCRKILEELYSTSYN---
2d1yC           VLFLASEKASFITGAILPVDGG---
2d1yD           VLFLASEKASFITGAILPVDGG---
2a4kA           ALFLLSEESAYITGQALYVDGG---
1a9zA           GNDYPTEDGTGVRD-----------
3deyX           FLTAL--------------------
2belA           SSLWTT-------------------
3ctmF           YLYLASNASTFTTGSDVVIDGGYTC
3d3wA           ILFLLSDRSGMTTGSTLPVEGG---
2b35E           VCALLSDWLPATTGDIIYADGG---
3d5qD           SSLLIRNPSRKILEFLY--------
1dj2A           VAYKRSDGTPVKS------------
1edoA           VEFLLSPAASYITGQAFTIDGGIAI
2b35A           VCALLSDWLPATTGDIIYADGG---
2b4qB           AISLAGTAGAYMTGNVIPIDGGFHL
3ce6B           -------------------------
3ek2B           GAFLLSDLASGVTAEVMHVDSG---
3ctmH           YLYLASNASTFTTGSDVVIDGGYTC
3ek2A           GAFLLSDLASGVTAEVMHVDSG---
3e03C           AHAVLTREAAGFHGQFLIDDEV---
2belD           TTLLIRNPCRKI-------------
2ag5B           CVYLASDESAYVTGNPVIIDGGWSL
3dwfB           VPYLLGNPGRKIMEELSAAEYN---
2dknA           IAFLLGPQASFIHGSVLFVDGG---
3edmB           VAFLASDDAAYVTGACYDINGG---
2ag5C           CVYLASDESAYVTGNPVIIDGGWSL
2ehdA           -------------------------
1d7oA           AAFLVSPLASAITGATIYVDNG---
3e03B           AHAVLTREAAGFHGQFLIDDEV---
2cnbB           DYPTPDGTCVRDYVHVCDLASA---
1dhrA           FHDWITGNKRPNSGSLIQVVTTD--
3csdB           VAYLIGPGAAAVTAQALNVCGG---
2e6hB           GTDRWAVAQGFVSATPLRLDLT---
2e6gK           GTDRWAVAQGFVSATPLRLDLT---
1cwuA           AAFLVSPLASAITGATIYVDNG---
3ek2C           GAFLLSDLASGVTAEVMHVDSG---
3e9qA           -YLWLGDDSRRKTGTFDAQPGR---
3ek2D           GAFLLSDLASGVTAEVMHVDSG---
3d7lA           ARAFEKSVFGAQTGESYQV------
2ekpA           AAVLCGDEAEYLTGQAVAVDGG---
3bmeC           VIFLVSGSAQYITGSIIKVDGGLSL
2e6cC           GTDRWAVAQGFVSATPLRLDLT---
3d4nD           STLLIRNPSRKILEFLY--------
3d5qB           TTLLIRNPSRKILEFLYST------
2dfdA           EVVKAKAGAGSATLSMAYAGA----
1c3vA           VRRIAERPGLVGLEPLL--------
2eghA           KISVDSATMMNKGLEYIEARW----
2b36B           VCALLSDWLPATTGDIIYADGG---
3dijA           VLFLCQ--QDFITGETIIVDGG---
3diiA           VLFLCQ--QDFITGETIIVDGG---
3ch6A           TTLLIRNPCRKILEELYSTSYN---
2b35C           VCALLSDWLPATTGDIIYADGG---
3dwfA           ITALRQDEMYYVGSRWV--------
1bmdA           FIPTVAQRGAAI-------------
3ce6A           -------------------------
2a4kB           ALFLLSEESAYITGQALYVDGG---
1dohA           VCFLASNDGGWVTGKVIGIDGGACM
3d4nC           SSLLIRNPSRKILEFLY--------
3dwfC           IGTALRQDEMYYVGS----------
2aqkA           VCALLSDWLPATTGDIIYADGG---
3ch6D           TTLLIRNPCRKILEELYST------
2aw5C           EAFVRSQMYSTDYDQI---------
1c14A           AAFLCSDLSAGISGEVVHVDGG---
2b37C           VCALLSDWLPATTGDIIYADGG---
3e03A           AHAVLTREAAGFHGQFLIDDEV---
3d4nB           TTLLIRNPSRKILEFLYST------
3byzA           TTLLIRNPSRKILEFLY--------
3c6cA           ARTVIEHLGSVATPDEARDIGL---
1ahhA           ALFLCSPAASWVSGQILTVSGG---
3d7lD           ARAFEKSVFGAQTGESYQV------
1bhsA           FLTALRAPLRYFTTERF--------
3edmA           VAFLASDDAAYVTGACYDINGG---
3bhmA           HGQFVSEKR----------------
2bgkA           VAYLAGDESKYVSGLNLVIDGG---
3ce6D           -------------------------
3bzuA           TTLLIRNPSRKILEFLYSTSYN---
2aw5B           IVKDAYQEKTATVYPEP--------
2aqiA           VCALLSDWLPATTGDIIYADGG---
3ctmG           YLYLASNASTFTTGSDVVIDGG---
2ehdB           -------------------------
3bzuD           TTLLIRNPSRKILEFLY--------
2aq8A           VCALLSDWLPATTGDIIYADGG---
2dknB           IAFLLGPQASFIHGSVLFVDGG---
2e6hD           DRWAVA--QGFVSATPLRLDLT---
2b35D           VCALLSDWLPATTGDIIYADGG---
2ekqD           AAVLCGDEAEYLTGQAVAVDGG---
2cnbC           -------------------------
2ae2A           VAFLCFPAASYVTGQIIYVDGG---
2belB           TTLLIRNPCRKI-------------
2b35B           VCALLSDWLPATTGDIIYADGG---
3d3eB           SSLLIRNPSRKILEFLY--------
1bxkB           LYCVATTGKVGETYNIGGHNE----
3ctmA           YLYLASNASTFTTGSDVVIDGG---
3d3uA           LTAIAHPDFRALEEEIR--------
3cq0B           KVSFINDEPHFRYVLNEDQMAT---
2cnbA           DKRMPIFGTDYPTPDGTC-------
3ctmB           YLYLASNASTFTTGSDVVIDGGYTC
2c07A           ACFLSSDKSGYINGRVFVIDGG---
2bfaA           VIFLCSSKAKYITGTCVKVDGGYSL
3d7lB           ARAFEKSVFGAQTGESYQV------
2aqhA           VCALLSDWLPATTGDIIYADGG---
2b4qA           AISLAGTAGAYMTGNVIPIDGGFHL
1a9yA           GNDYPTEDGTGVRDYIHVMD-----
3d4nA           TTLLIRNPSRKILEFLY--------
3ctmE           YLYLASNASTFTTGSDVVIDGG---
3cxtA           AVFLASDASNFVNGHILYVDGG---
1e3sA           VQMVIE--NPFLNGEVIRLDGA---
1ae1A           IAFLCFPAASYITGQIIWADGG---
2bd0A           VVQAYLQPSRTVVEEILRPTSG---
2e37D           TYYGIGAGLARLVRAILTDEKG---
2b35F           VCALLSDWLPATTGDIIYADGG---
1e3wA           VQMVIE--NPFLNGEVIRLDGA---
1cydA           ILFLLSDRSASTSGGGILVDAG---
1ae1B           IAFLCFPAASYITGQIIWADGG---
1a4uA           NFVKAI--EANKNGAIWKLDLG---
3d5qA           SSLWTTLLIRNPSRKILEFLYSTSY
2bf7A           VIFLCSSKAKYITGTCVKVDGGYSL
2b37B           VCALLSDWLPATTGDIIYADGG---
1bdbA           YVFFATRDAAPATGALLNYDGG---
2a92C           IFDRTVNTALEIVNLLASP------
3ctmD           YLYLASNASTFTTGSDVVIDGGYTC
3bmnD           VIFLVSGSAQYITGSIIKVDGGLSL
3c2qA           -------------------------
3cxrA           AVFLASDASNFVNGHILYVDGG---
1e6wB           VQMVIE--NPFLNGEVIRLDGA---
2bfmB           VIFLCSSKAKYITGTCVKVDGGYSL
1e7wB           VIFLCSSKAKYITGTCVKVDGGYSL
2dteA           VAFLASREASFITGTCLYVDGG---
2bfpB           VIFLCSSKAKYITGTCVKVDGGYSL
2bfoA           VIFLCSSKAKYITGTCVKVDGGYSL
2e6bC           --DRWAVAQGFVSATPLRLD-----
3e48A           -------------------------
1b8pA           VGKR---------------------
3bmqA           VIFLVSGSAQYITGSIIKVDGGLSL
1e92A           VIFLCSSKAKYITGTCVKVDGGYSL
1c9yA           -------------------------
2aw5A           IAEKIVKDAYQEKTATVYPEPQ---
2bf7B           VIFLCSSKAKYITGTCVKVDGGYSL
1e6wC           VQMVIE--NPFLNGEVIRLDGA---
2e6cD           GTDRWAVAQGFVSATPLRLD-----
2c7vD           VIFLVSGSAQYITGSIIKVDGGLSL
3bmfB           VIFLVSGSAQYITGSIIKVDGGLSL
2bfaD           VIFLCSSKAKYITGTCVKVDGGYSL
3bzuC           SSLWTTLLIRNPSRKILEFLYS---
3edmD           VAFLASDDAAYVTGACYDING----
3e9qB           LYLWLGDDSRRKTGTFDAQPGR---
2c7vB           VIFLVSGSAQYITGSIIKVDGGLSL
2bfaB           VIFLCSSKAKYITGTCVKVDGGYSL
3c2qB           -------------------------
1e6wD           VQMVIEN--PFLNGEVIRLDGA---
2e6bD           GTDRWAVAQGFVSATPLRLD-----
3bmnB           VIFLVSGSAQYITGSIIKVDGGLSL
3edmC           VAFLASDDAAYVTGACYDING----
1e6wA           VQMVIE--NPFLNGEVIRLDGA---
3ctmC           YLYLASNASTFTTGSDVVIDGG---
1bdmA           FIP----------------------
2e37E           TYYGIGAGLARLVRAILTDEKG---
3bmnC           VIFLVSGSAQYITGSIIKVDGGLSL
2axqA           DLMATAKPYFIYPGYAFVCYPNR--
1e92B           VIFLCSSKAKYITGTCVKVDGGYSL
1di6A           -------------------------
2e6hC           GTDRWAVAQGFVSATPLRLD-----
1e7wA           VIFLCSSKAKYITGTCVKVDGGYSL
3dhnA           IDELEHPKH---HQERFTIGYL---
1c9kB           -------------------------
1dj3A           VSYNQGEKLQSFPGDLDTLEQVQVN
2c7vA           VIFLVSGSAQYITGSIIKVDGGLSL
3bmfC           VIFLVSGSAQYITGSIIKVDGGLSL
2e37B           TYYGIGAGLARLVRAILTDEKG---
3bmdB           VIFLVSGSAQYITGSIIKVDGGLSL
3d64A           -------------------------
3bmoA           VIFLVSGSAQYITGSIIKVDGGLSL
3bmiB           VIFLVSGSAQYITGSIIKVDGGLSL
3bmqC           VIFLVSGSAQYITGSIIKVDGGLSL
1e92D           VIFLCSSKAKYITGTCVKVDGGYSL
2bfoC           VIFLCSSKAKYITGTCVKVDGGYSL
3bmfD           VIFLVSGSAQYITGSIIKVDGGLSL
3dxfB           LTKHTRKVVHDAKMTPED-------
1bsvA           -------------------------
3e6vA           PIDYLN-------------------
1e7qA           -------------------------
2c7vC           VIFLVSGSAQYITGSIIKVDGGLSL
3bmoD           VIFLVSGSAQYITGSIIKVDGGLSL
1bxkA           LYCVATTGK----------------
2c5aB           -------------------------
2a92B           IFDRTVNTALEIVNLLASPYV----
3bmeA           VIFLVSGSAQYITGSIIKVDGGLSL
1e92C           VIFLCSSKAKYITGTCVKVDGGYSL
3bmfA           VIFLVSGSAQYITGSIIKVDGGLSL
3bmjD           VIFLVSGSAQYITGSIIKVDGGLSL
2bllA           LYRIIENAGNRCDGEIINIGNPE--
2bfpD           VIFLCSSKAKYITGTCVKVDGGYSL
3d7lF           ARAFEKSVFGAQTGESYQV------
3dfzA           -------------------------
3bmkC           VIFLVSGSAQYITGSIIKVDGGLSL
1c9kA           -------------------------
2bfmC           VIFLCSSKAKYITGTCVKVDGGYSL
2c29F           -------------------------
3c3xA           TIKVATDPRA--LNRVVIYRPST--
1d4fA           -------------------------
2bfaC           VIFLCSSKAKYITGTCVKVDGGYSL
2bkaA           MLNNVVRPRD--KQMELLENKAI--
1d4gA           -------------------------
3bmnA           VIFLVSGSAQYITGSIIKVDGGLSL
2c82A           PQSIIHSMVTFIDGSTIAQ------
2bf7C           VIFLCSSKAKYITGTCVKVDGGYSL
1b3rA           -------------------------
1bdmB           FIPTVAQRGAAI-------------
3e9nA           IRFVIDGETTQITNVDV--------
3dxfA           VLSLLKMPEKYVGQNIGLSTCR---
2c5eB           -------------------------
3bmeB           VIFLVSGSAQYITGSIIKVDGGLSL
2c59B           -------------------------
3e5mA           VLSLLKMPEKY-VGQNIGLSTCR--
1e7sA           -------------------------
2c54A           VLRLTKS----DFREPVNIGSD---
3bmoC           VIFLVSGSAQYITGSIIKVDGGLSL
2e37C           LA--------RLVRAILTDEKG---
2e6gA           DRWAV--AQGFVSATPLRLD-----
2bf7D           VIFLCSSKAKYITGTCVKVDGGYSL
2a35A           VRFVESDELRKLGKG----------
2e6gJ           GTDRWAVAQGFVSATPLRLD-----
2c59A           -------------------------
2c54B           -------------------------
1ek5A           GNDYDTEDGTGVRDYIHVV------
3e9nB           -------------------------
1di7A           -------------------------
2e37A           TYYGIGAGLARLVRAIL--------
1cg3A           FCLTKLDVLDGLKEVKLCVA-----
3e5mB           VLSLLKMPEKYVGQNIGLSTCRHTA
2c5eA           -------------------------
3e8xA           IAELVDQQH--TIGKTFEVLNG---
3e9nC           -------------------------
1cbuC           -------------------------
3d3jA           -------------------------
3e9nE           -------------------------
2e6eB           DRWAV--AQGFVSATPLRLD-----
1bwsA           -------------------------
2e6eD           -------------------------
2c20A           GDDYNTPDGTCIRDYIHVED-----
3dtdB           -------------------------
1a7aB           -------------------------
2a92A           -------------------------
3dqpA           IKELVTDHS---IGKVISHNGK---
2cukA           -------------------------
3e9nH           -------------------------
3e9nF           -------------------------
1edzA           -------------------------
3e9nD           -------------------------
1bw3A           -------------------------
2eezA           -------------------------
3dfzB           -------------------------
1a4iA           -------------------------
3donA           -------------------------
3d5tC           -------------------------
1e6uA           -------------------------
1civA           -------------------------
2c5aA           -------------------------
1buaB           NEIPKPYGVKVFLQDKWVIAG----
3dooA           -------------------------
3bywF           -------------------------
3bywB           -------------------------
2e6gG           RWAVAQG---FVSATPLRLD-----
1cg4A           K----LDVLDGLKEVKLCVA-----
3eheA           MLFGLRGDE---RVNIFNIGSEDQI
1a7aA           -------------------------
2a35B           VRFVESDELRKLGK-----------
2eggA           -------------------------
1cg1A           -------------------------
1a4iB           -------------------------
3bywC           -------------------------
1ddtA           GELVDIGFAAYNFVESIINLFQ---
1d0iA           -------------------------
3e48B           -------------------------
1adeA           -------------------------
2e6gB           RWAVAQG---FVSATPLRLD-----
2dt8A           -------------------------
2ef0A           -------------------------
3bywH           -------------------------
3dbrG           -------------------------
1db3A           -------------------------
3bywD           -------------------------
3d5tA           -------------------------
3c1oA           -------------------------
3bywA           -------------------------