[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31053.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1do2A.bssp"
#ERROR : Can't open dsspfile "1e94E.bssp"
#ERROR : Can't open dsspfile "1dooE.bssp"
#ERROR : Can't open dsspfile "2dlaB.bssp"
#ERROR : Can't open dsspfile "1bofA.bssp"
#ERROR : Can't open dsspfile "3cfuA.bssp"
#ERROR : Can't open dsspfile "1d0sA.bssp"
#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "3c7zA.bssp"
#ERROR : Can't open dsspfile "3c3bB.bssp"
#ERROR : Can't open dsspfile "1bpoB.bssp"
#ERROR : Can't open dsspfile "3cf1B.bssp"
#ERROR : Can't open dsspfile "3c39A.bssp"
#ERROR : Can't open dsspfile "3cinA.bssp"
#ERROR : Can't open dsspfile "3cf2A.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3cf0A.bssp"
#ERROR : Can't open dsspfile "1bpoA.bssp"
#ERROR : Can't open dsspfile "1d2nA.bssp"
#ERROR : Can't open dsspfile "2c99A.bssp"
#ERROR : Can't open dsspfile "2dwuA.bssp"
#ERROR : Can't open dsspfile "3ec2A.bssp"
#ERROR : Can't open dsspfile "3bosA.bssp"
#ERROR : Can't open dsspfile "2dhrA.bssp"
#ERROR : Can't open dsspfile "3d8bB.bssp"
#ERROR : Can't open dsspfile "3d8bA.bssp"
#ERROR : Can't open dsspfile "2cvxA.bssp"
#ERROR : Can't open dsspfile "3bosB.bssp"
#ERROR : Can't open dsspfile "2dhrB.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "2c96A.bssp"
#ERROR : Can't open dsspfile "2c98A.bssp"
#ERROR : Can't open dsspfile "3b9pA.bssp"
#ERROR : Can't open dsspfile "3co5A.bssp"
#ERROR : Can't open dsspfile "2chqA.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2dhrF.bssp"
#ERROR : Can't open dsspfile "3eihB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3eccA.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2dhrD.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2chgA.bssp"
#ERROR : Can't open dsspfile "3c3bA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3eihA.bssp"
#ERROR : Can't open dsspfile "2c9cA.bssp"
#ERROR : Can't open dsspfile "2dwuB.bssp"
#ERROR : Can't open dsspfile "3ckdC.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2azpA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3co5B.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "2bjvA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2bjwA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2ak3A.bssp"
#ERROR : Can't open dsspfile "2chgB.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2ce7B.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "2ce7C.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2bbwA.bssp"
#ERROR : Can't open dsspfile "2chgC.bssp"
#ERROR : Can't open dsspfile "2ce7A.bssp"
#ERROR : Can't open dsspfile "3d3xB.bssp"
#ERROR : Can't open dsspfile "3e2eA.bssp"
#ERROR : Can't open dsspfile "2efcA.bssp"
#ERROR : Can't open dsspfile "2ce7D.bssp"
#ERROR : Can't open dsspfile "3akyA.bssp"
#ERROR : Can't open dsspfile "2ak3B.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "1b1cA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2ce7F.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1eaqA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"

## Summary of PDB Search
:455
    2e-19  72%  1do2A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    2e-19  72%  1e94E  [c.37.1] HEAT SHOCK PROTEIN HSLU
    3e-19  72%  1dooE  [c.37.1 (1g4bE)] HEAT SHOCK LOCUS U
    3e-18  11%  2dlaB  [x.x.x] 397AA LONG HYPOTHETICAL PROTEIN
    4e-18  16%  1bofA  [x.x.x] GI ALPHA 1
    1e-16  11%  3cfuA  [x.x.x] UNCHARACTERIZED LIPOPROTEIN YJHA
    9e-16  11%  1d0sA  [c.39.1] NICOTINATE MONONUCLEOTIDE:5,6-[MASQUE : MEMB(X) 46 /
    5e-14  69%  1do0A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    1e-12  12%  3c7zA  [x.x.x] LYSOZYME
    2e-12  10%  3c3bB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    6e-12   8%  1bpoB  [b.69.6 - a.118.1] PROTEIN (CLATHRIN)
    3e-11  17%  3cf1B  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    5e-11  10%  3c39A  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-10  14%  3cinA  [c.2.1 - d.81.1 (1vjpA)] MYO-INOSITOL-1-PHOSPHATE
    3e-10  23%  3cf2A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    2e-09  18%  2c9oB  [x.x.x] RUVB-LIKE 1
    4e-09  21%  3cf0A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    6e-09   9%  1bpoA  [b.69.6 - a.118.1] PROTEIN (CLATHRIN)
    7e-09  23%  1d2nA  [c.37.1] N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
    1e-08  23%  2c99A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-08  14%  2dwuA  [x.x.x] GLUTAMATE RACEMASE
    2e-08  20%  3ec2A  [x.x.x] DNA REPLICATION PROTEIN DNAC
    2e-08  15%  3bosA  [x.x.x] PUTATIVE DNA REPLICATION FACTOR
    4e-08  36%  2dhrA  [x.x.x] FTSH
    5e-08  24%  3d8bB  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    6e-08  26%  3d8bA  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    7e-08  13%  2cvxA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    7e-08  10%  3bosB  [x.x.x] PUTATIVE DNA REPLICATION FACTOR
    7e-08  46%  2dhrB  [x.x.x] FTSH
    9e-08   9%  1a5tA  [x.x.x] DELTA PRIME
    1e-07  23%  2c96A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-07  23%  2c98A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-07  28%  3b9pA  [x.x.x] CG5977-PA, ISOFORM A
    2e-07  12%  3co5A  [x.x.x] PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL
    2e-07  19%  2chqA  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    2e-07  23%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  48%  2dhrF  [x.x.x] FTSH
    2e-07  27%  3eihB  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    2e-07  23%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07  20%  3eccA  [x.x.x] DNA REPLICATION PROTEIN DNAC
    3e-07  18%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-07  46%  2dhrD  [x.x.x] FTSH
    3e-07  19%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07  16%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-07  22%  2chgA  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    8e-07  11%  3c3bA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    9e-07  39%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-06  23%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06  22%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06  20%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06  27%  3eihA  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    2e-06  23%  2c9cA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    2e-06  15%  2dwuB  [x.x.x] GLUTAMATE RACEMASE
    2e-06   8%  3ckdC  [x.x.x] INVASION PLASMID ANTIGEN, SECRETED BY THE MXI-SPA
    4e-06  25%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    6e-06  25%  1e2jB  [c.37.1] THYMIDINE KINASE
    6e-06   9%  2azpA  [x.x.x] HYPOTHETICAL PROTEIN PA1268
    6e-06  21%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-06  12%  3cmuA  [x.x.x] PROTEIN RECA
    8e-06  20%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-06  25%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    8e-06  12%  3co5B  [x.x.x] PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL
    9e-06   8%  3cmwA  [x.x.x] PROTEIN RECA
    1e-05  31%  2bjvA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-05  22%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-05  30%  2bjwA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    2e-05  22%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-05  22%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-05  20%  2ak3A  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    3e-05  23%  2chgB  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    4e-05  25%  1e2lB  [c.37.1] THYMIDINE KINASE
    5e-05  34%  2ce7B  [x.x.x] CELL DIVISION PROTEIN FTSH
    5e-05  26%  1akyA  [x.x.x] ADENYLATE KINASE
    5e-05  26%  2cdnA  [x.x.x] ADENYLATE KINASE
    5e-05  25%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    5e-05  34%  2ce7C  [x.x.x] CELL DIVISION PROTEIN FTSH
    8e-05  23%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    9e-05  20%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-05  12%  2c95B  [x.x.x] ADENYLATE KINASE 1
    1e-04  25%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    1e-04  13%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-04  16%  2bbwA  [x.x.x] ADENYLATE KINASE 4, AK4
    2e-04  21%  2chgC  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    2e-04  45%  2ce7A  [x.x.x] CELL DIVISION PROTEIN FTSH
    2e-04  19%  3d3xB  [x.x.x] TYPE E BOTULINUM TOXIN
    2e-04   7%  3e2eA  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    2e-04   7%  2efcA  [x.x.x] SIMILARITY TO VACUOLAR PROTEIN SORTING-
    2e-04  34%  2ce7D  [x.x.x] CELL DIVISION PROTEIN FTSH
    3e-04  28%  3akyA  [x.x.x] ADENYLATE KINASE
    3e-04  15%  2ak3B  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    3e-04  25%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    3e-04  19%  1b1cA  [c.23.5] PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
    3e-04  21%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-04  18%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-04  25%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-04  25%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    6e-04  19%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-04  34%  2ce7F  [x.x.x] CELL DIVISION PROTEIN FTSH
    8e-04  15%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    9e-04  29%  1e2hB  [c.37.1] THYMIDINE KINASE
    0.001  35%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    0.001   7%  1eaqA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    0.001  23%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
1do2A           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1e94E           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1dooE           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
2dlaB           ----------------------------------------------------------------------
1bofA           --------------------------------RSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQ
3cfuA           ----------------------------------------------------------------------
1d0sA           AEPIPGVVNMRVARGCGNIAVGPAMSRLQAEALLLEVSRYACDLAQRGV---TLFGVGELGMANTTPAAA
1do0A           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
3c7zA           --EAEKLFNQDVDAAVRGILRNAKLKPVYASLDAVRHCAL----------INMVFQMGETGVAGFTNSLR
3c3bB           ----ENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWN-GPVGVFEWEAFARGTKALMDE
1bpoB           ----------------------------------------------------------------------
3cf1B           IKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALF-KAIGVKPPRGILLYGPPGTGKTLIARA
3c39A           ----ENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWN-GPVGVFEWEAFARGTKALMDE
3cinA           -----------HMVKVLILGQGYVASTFVAGLEKLRKGEIEPYGVPLPIGFEDIKIVGSYDVDRAKIGKK
3cf2A           ----DEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKTLIARA
2c9oB           ------------QAASGLVGQENAREACGVIVELIKSKKM---------AGRAVLLAGPPGTGKTALALA
3cf0A           ----ETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFG-MTPSKGVLFYGPPGCGKTLLAKA
1bpoA           ----------------------------------------------------------------------
1d2nA           ------------YIMNGIIKWGDPVTRVLDDGELLVQQT----KNSDRTPLVSVLLEGPPHSGKTALAAK
2c99A           -----------------LLGEANSFLEVLEQVSHLAP------------LDKPVLIIGERGTGKELIASR
2dwuA           ---------------------------------------------------HSVIGVLDSGVGGLTVASE
3ec2A           ------WNANLDTYHPKNVSQNRALLTIRVFVHNFNPE-----------EGKGLTFVGSPGVGKTHLAVA
3bosA           -------------FTSYYPGNDELIGALKSAASGD--------------GVQAIYLWGPVKSGRTHLIHA
2dhrA           --------------------------------------------------PKGVLLVGPPGVGKTHLARA
3d8bB           LIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRG--PPKGILLFGPPGTGKTLIGKC
3d8bA           --MNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRG--PPKGILLFGPPGTGKTLIGKC
2cvxA           ---LPAFIETSEDGKTSTYNFKKLHEIAKVVTRNLNRVIDRNYYPVEEAR-KSNMRHRPIALGVQGLADT
3bosB           -----------------YYPAAGNDELIGALKSAASGD-----------GVQAIYLWGPVKSGRTHLIHA
2dhrB           --------------------------------------------------PKGVLLVGPPGVGKTHLARA
1a5tA           ---------------RWYPWLRPDFEKLVASYQAGR-------------GHHALLIQALPGMGDDALIYA
2c96A           -----------------LLGEANSFLEVLEQVSHLAPL------------DKPVLIIGERGTGKELIASR
2c98A           -----------------LLGEANSFLEVLEQVSHLAP------------LDKPVLIIGERGTGKELIASR
3b9pA           LILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRA--PAKGLLLFGPPGNGKTLLARA
3co5A           -------------------GNSAAIQENREVEAAAK-------------RTSPVFLTGEAGSPFETVARY
2chqA           -----------------VVGQDEVIQRLKGYVERK--------------NIPHLLFSGPPGTGKTATAIA
1e9sK           ------------PFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
2dhrF           --------------------------------------------------PKGVLLVGPPGVGKTHLARA
3eihB           ---------------EDVAGLEGAKEALKEAVILPVKFPHLFKGNRK--PTSGILLYGPPGTGKSYLAKA
1e9rB           ------------PFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
3eccA           ------WNANLDTYHPKNVSQNRALLTIRVFVHNFNPE-----------EGKGLTFVGSPGVGKTHLAVA
1eg7A           -----AKMKPVMELARGLGIQEDEVELYGKYKAKISLDVYRRLKDKPDGKLILVTAITPAGEGKTTTSVG
2dhrD           --------------------------------------------------PKGVLLVGPPGVGKTHLARA
1e9sM           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
1eg7B           ---QAAKMKPVMELARGLGIQEDEVELYGKYKAKISLDVYRRLKDKPDGKLILVTAITPAGEGKTTTSVG
2chgA           -----------------VVGQDEVIQRLKGYVERK--------------NIPHLLFSGPPGTGKTATAIA
3c3bA           -------ATVASGIPAGWMGLDCGPESSYAEAVTRAKQIVWN-------GPVGVFEWEAFARGTKALMDE
3crmA           --------------------------------------------------PPAIFLMGPTAAGKTDLAMA
1e9sL           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
1e9sE           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
1e9sA           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLR-
3eihA           -----------------VAGLEGAKEALKEAVILPVKFPHLFKGNRK--PTSGILLYGPPGTGKSYLAKA
2c9cA           -----------------LLGEANSFLEVLEQVSHLAPL------------DKPVLIIGERGTGKELIASR
2dwuB           ---------------------------------------------------HSVIGVLDSGVGGLTVASE
3ckdC           -------------------------------AAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNL
2bwjE           --------------------------------------------------CKIIFIIGGPGSGKGTQCEK
1e2jB           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
2azpA           --------------------------------------------------TRLVIGGFPDLGQGDMAERR
1e9sB           ---------GGAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
3cmuA           ----AAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGVEIYGPESSGKTTLTLQ
1e9sH           ---VGQGEFGGAPFKRFLRGTIVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
2bwjD           --------------------------------------------------CKIIFIIGGPGSGKGTQCEK
3co5B           -------------------------------------------------RTSPVFLTGEAGSPFETVARY
3cmwA           ----ALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQ
2bjvA           -------------------GEANSFLEVLEQVSHLAP------------LDKPVLIIGERGTGKELIASR
1e9rG           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
2bjwA           ------------------LGEANSFLEVLEQVSHLAP------------LDKPVLIIGERGTGKELIASR
1e9sI           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
1e9rF           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLRE
2ak3A           --------------------------------------------------LLRAAIMGAPGSGKGTVSSR
2chgB           ----------------EVVGQDEVIQRLKGYVERK--------------NIPHLLFSGPPGTGKTATAIA
1e2lB           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
2ce7B           -----------------VGGAEEAIKEVVEFLKDPSKFNRIGAR-----MPKGILLVGPPGTGKTLLARA
1akyA           --------------------------------------------------SIRMVLIGPPGAGKGTQAPN
2cdnA           --------------------------------------------------HMRVLLLGPPGAGKGTQAVK
2bwjF           --------------------------------------------------CKIIFIIGGPGSGKGTQCEK
2ce7C           -----------------VGGAEEAIKEVVEFLKDPSKFNRIGAR-----MPKGILLVGPPGTGKTLLARA
3czpA           -------------FESAEVGHSIDKDTYEKAVIELREALLQFELKQQARFPVIILINGIEGAGKGETVKL
1e9sJ           ----------GAPFKRFLRGTRVSGGKLKRMTREKAKQVTVAGVMPRDAEPRHLLVNGATGTGKSVLLR-
2c95B           --------------------------------------------------TNIIFVVGGPGSGKGTQCEK
1e32A           -------EESLNEVGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARA
1e2hA           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
2bbwA           --------------------------------------------------LLRAVILGPPGSGKGTVCQR
2chgC           -----------------VVGQDEVIQRLKGYVERK--------------NIPHLLFSGPPGTGKTATAIA
2ce7A           -------------------------------------------------MPKGILLVGPPGTGKTLLARA
3d3xB           ---------------------------------------------NDPVNDRTILYIKPGGCQEFYKSFN
3e2eA           INDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITI--KTTLACLTSAD---NTTVQAVASAIGRAIEDEA
2efcA           ----------------------------------------------------------------------
2ce7D           -----------------VGGAEEAIKEVVEFLKDPSKFNRIGAR-----MPKGILLVGPPGTGKTLLARA
3akyA           --------------------------------------------------SIRMVLIGPPGAGKGTQAPN
2ak3B           --------------------------------------------------LLRAAIMGAPGSGKGTVSSR
2bwjC           --------------------------------------------------CKIIFIIGGPGSGKGTQCEK
1b1cA           -------------------------------------------------TGRNIIVFYGSQTGTAEFANR
3dkvA           ----------------------------------------------------NIVLMGLPGAGKGTQAER
1dekB           -----------------------------------------------------IFLSGVKRSGKDTTADF
1e2nA           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
2bwjA           --------------------------------------------------CKIIFIIGGPGSGKGTQCEK
1e9sF           ----------GAPFKRFLRGTRIVSGKLKRMTREKAKQVTVAGPMPRDAEPRHLLVNGATGTGKSVLLRE
2ce7F           -----------------VGGAEEAIKEVVEFLKDPSKFNRIGAR-----MPKGILLVGPPGTGKTLLARA
1d2mA           ----------------------------------------------------------------------
1e2hB           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
3czpB           ----------------HSIDKDTYEKAVI-ELREALLEAQLKQQARF---PVIILINGIEGAGKGETVKL
1eaqA           ----------------------------------------------------------------------
1ckeA           --------------------------------------------------APVITIDGPSGAGKGTLCKA


                         .         .         *         .         .         .         .:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1do2A           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDL------------------------------------
1e94E           LAKLANAPFIKVEATKFTEVGYVGKE--------------------------------------------
1dooE           LAKLANAPFIKVEATKF-----------------------------------------------------
2dlaB           ----------------------------------------------------------------------
1bofA           MKIIHEAGYSEEECKQYKAVVY--SNTIQSIIAIIRAMGRL-----------------------------
3cfuA           ----------------------------------------------------------------------
1d0sA           MSVFTGSDAKEVVGIGANLPPSIDNKVDVVRRAI------------------------------------
1do0A           LAKLANAPFIKVEATKFTE---------------------------------------------------
3c7zA           MLQ-QKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTG--------------------------------
3c3bB           VVKATSRGCITIIGGDK--VSHVSTGGGASLELLEG----------------------------------
1bpoB           ----------------------------------------------------------------------
3cf1B           VANETGAFFFLINGPEIMS---------------------------------------------------
3c39A           VVKATSRGCITIIGGDK--VSHVSTGGGASLELLEGKVLP------------------------------
3cinA           LSEVVKQYWNDVDSLTSDKGVHLGSVRNLPIEAE------------------------------------
3cf2A           VANETGAFFFLINGPEIMS---------------------------------------------------
2c9oB           IAQELGSKVPFCPMVGSEVYST------------------------------------------------
3cf0A           IANECQANFISIKGPELLT---------------------------------------------------
1bpoA           ----------------------------------------------------------------------
1d2nA           IAEESNFPFI------------------------------------------------------------
2c99A           LHYLSSRWQGPFISLNCAA---------------------------------------------------
2dwuA           IIRQLPKESICYIGDNERCPY--GPRSVEEVQSFVFEMVE------------------------------
3ec2A           TLKAIYEKKGIR----------------------------------------------------------
3bosA           ACARANELERRSFYIPLG----------------------------------------------------
2dhrA           VAGEARVPFITASGSDFVE-MFVG-VGAARVRDLFETAKRH-----------------------------
3d8bB           IASQSGATFFSISASSLTEGEKMVRALFAVAR--------------------------------------
3d8bA           IASQSGATFFSISASSLTS---------------------------------------------------
2cvxA           FMLL-RLPFDSEEARLLNIQHASMEASCELAQKD------------------------------------
3bosB           ACARANELERRSFYIPLGI---------------------------------------------------
2dhrB           VAGEARVPFITASGSDFVE-MFVG-VGAARVRDLFETAKRH-----------------------------
1a5tA           LSRYLLCQQPQGHKSCGHCRGCQLMQA-------------------------------------------
2c96A           LHYLSSRWQGPFISLNCAALNENLLDSE------------------------------------------
2c98A           LHYLSSRWQGPFISLNCAA---------------------------------------------------
3b9pA           VATECSATFLNISAASLTS---------------------------------------------------
3co5A           FHKNGTPWVSPARVEYLIDPELLQKAEGGVL---------------------------------------
2chqA           LARDLFGENWRDNFIEMNASDERG--IDVVRHKIKEFARTA-----------------------------
1e9sK           LAYT------------------------------------------------------------------
2dhrF           VAGEARVPFITASGSDFVE-MFVG-VGAARVRDLFETA--------------------------------
3eihB           VATEANSTFFSVSSSDL-----------------------------------------------------
1e9rB           LAYT------------------------------------------------------------------
3eccA           TLKAIYEKKGIR----------------------------------------------------------
1eg7A           LTDALARLGKRV----------------------------------------------------------
2dhrD           VAGEARVPFITASGSDFVE-MFVG-VGAARVRDLFETAKRH-----------------------------
1e9sM           LAYTGLLRGDRM----------------------------------------------------------
1eg7B           LTDALARLGKRVMVCLREPSLGP-----------------------------------------------
2chgA           LARDLFGENWRDNFI-------------------------------------------------------
3c3bA           VVKATSRGCITIIGGDK--VSHVSTGGGASLELLEGKV--------------------------------
3crmA           LADALPCELISVD---------------------------------------------------------
1e9sL           LA--------------------------------------------------------------------
1e9sE           LAYT------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3eihA           VATEANSTFFSVSSSDLVS---------------------------------------------------
2c9cA           LHYLSSRWQGPFISLNCAA---------------------------------------------------
2dwuB           IIRQLPKESICYIGDNERCP-YGPRSVEEVQSFVFEMVEFL-----------------------------
3ckdC           RKTLLVHQASEGLFDNDTG-ALLSLGREFRLEILEDIARDK-----------------------------
2bwjE           LVEKYGFTHLST----------------------------------------------------------
1e2jB           LVALGSRDDIVYVPEPMTYWRVLG----------------------------------------------
2azpA           RLLGERHDAWRAACILEPRGSDVLV---------------------------------------------
1e9sB           LAYTGLL---------------------------------------------------------------
3cmuA           VIAAAQREGKTC----------------------------------------------------------
1e9sH           LA--------------------------------------------------------------------
2bwjD           LVEKYGFTHLST----------------------------------------------------------
3co5B           FHKNGTPWVSPARVEYLIDPELLQKAEGGVL---------------------------------------
3cmwA           VIAAAQREGKTCAFIDAEH---------------------------------------------------
2bjvA           LHY-------------------------------------------------------------------
1e9rG           LAYT------------------------------------------------------------------
2bjwA           LHY-------------------------------------------------------------------
1e9sI           LAYT------------------------------------------------------------------
1e9rF           LAYT------------------------------------------------------------------
2ak3A           ITKHFELKHL------------------------------------------------------------
2chgB           LARDLFGENWRD----------------------------------------------------------
1e2lB           LVALGSRDDIVYVPEPMTYWRVLG----------------------------------------------
2ce7B           VAGEANVPFFHISGSDFVE---------------------------------------------------
1akyA           LQERFHAAHLATGD--------------------------------------------------------
2cdnA           LAEKLGIPQISTGELFRRNIEE------------------------------------------------
2bwjF           LVEKYGFTHLST----------------------------------------------------------
2ce7C           VAGEANVPFFHISGSDFVE---------------------------------------------------
3czpA           LNEW------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2c95B           IVQKYGYTHLSTGDLLRSEVSS--GSARGKKLSEIMEK--------------------------------
1e32A           VANETGAFFFLINGPEIMSK-LAG-ESESNLRKAFEEA--------------------------------
1e2hA           LRDDIVYVPEPMTYWRVLGASETIANIYTTQH--------------------------------------
2bbwA           IAQNFGLQHLSSGHFLRENIKAST----------------------------------------------
2chgC           LARDLFGENWRDNFIEMNA---------------------------------------------------
2ce7A           VAGEANVPFFHISGSDFVE---------------------------------------------------
3d3xB           IMNIWIIPERNVIGTTPQDFHPPTKNG-------------------------------------------
3e2eA           RFG-------------------------------------------------------------------
2efcA           ----------------------------------------------------------------------
2ce7D           VAGEANVPFFHISGSDFVE---------------------------------------------------
3akyA           LQERFHAAHLAT----------------------------------------------------------
2ak3B           ITKHFELKHLSSGDLLRDN---------------------------------------------------
2bwjC           LVEKYGFTHLST----------------------------------------------------------
1b1cA           LSKDYGMRGMSADPEEYDLADLSSLPE-------------------------------------------
3dkvA           IVEKYGIPHISTGDMFRAAMKEETPLGLEA----------------------------------------
1dekB           IMSNYSAVKYQLAGPIKDALAYA-----------------------------------------------
1e2nA           LVALGSRDDIVYVPEPMTYWRVLG----------------------------------------------
2bwjA           LVEKYGFTHLST----------------------------------------------------------
1e9sF           LAYTGLLRGDRM----------------------------------------------------------
2ce7F           VAGEANVPFFHISGSDFVE---------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1e2hB           LVALGSRDDIV-----------------------------------------------------------
3czpB           LNEW------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1ckeA           MAEALQWHLL------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1do2A           ----------------------------------------------------------------------
1e94E           ----------------------------------------------------------------------
1dooE           ----------------------------------------------------------------------
2dlaB           ----------------------------------------------------------------------
1bofA           ----------------------------------------------------------------------
3cfuA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
3c7zA           ----------------------------------------------------------------------
3c3bB           ----------------------------------------------------------------------
1bpoB           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
3c39A           ----------------------------------------------------------------------
3cinA           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
1bpoA           ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2dwuA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
2dhrA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2cvxA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
2dhrB           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2dhrD           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3c3bA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3eihA           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
3ckdC           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2bbwA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
3e2eA           ----------------------------------------------------------------------
2efcA           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
2ak3B           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNS
1do2A           -------------------------------------------------------FIDEIDKICKRGESS
1e94E           ------------------------------------------QDAIDAVEQHGIVFIDEIDKICKRGESS
1dooE           ---------------------------------------------------------DEIDKICKRGESS
2dlaB           ----------------------------------------------------------------------
1bofA           ----------------------------------------------------------------------
3cfuA           ---------------------------------------------------------------------K
1d0sA           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
3c7zA           ----------------------------------------------------------------------
3c3bB           ----------------------------------------------------------------------
1bpoB           --------------------------------------------------QILPIRFQEHLQLQGINPAN
3cf1B           ----------------------------------------------------CVLFFDELDSIAKARGGN
3c39A           ----------------------------------------------------------------------
3cinA           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
1bpoA           --------------------------------------------------QILPIRFQEHLQLQGINPAN
1d2nA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2dwuA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
2dhrA           --------------------------------------------------APCIVFIDEIDAVGRKSGVG
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2cvxA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
2dhrB           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2dhrD           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3c3bA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3eihA           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
3ckdC           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2bbwA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
3e2eA           ----------------------------------------------------------------------
2efcA           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
2ak3B           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
1d2mA           -------------------------LAPNKILAAQLAAEFRELFPENAV----EYFISYYDYYQPEAYVP
1e2hB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1eaqA           ---------------------------------------DHPGELVRTDSPNFLSSVLPTHWRSNKTLP-
1ckeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIE
1do2A           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1e94E           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1dooE           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
2dlaB           ------------------------------------------ELLKGFGSINDFMDAIPKIVSVDDVI--
1bofA           ----------------------------------------------------------------------
3cfuA           IGETFKAGHTNFTVNKVDRVQKGEYNVKDDEERLIIEVTGEDSISYNFIFSIEEKGRILGGVSGKKVTGV
1d0sA           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
3c7zA           ----------------------------------------------------------------------
3c3bB           ----------------------------------------------------------------------
1bpoB           IGFSTLTMESDKFI------CIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTL
3cf1B           IGDGGGAADRVINQILTEMDGMSTKKNVFIIGAAILRPGRLDQLIYIPLPDEKSRVAILKANKSPVAKDV
3c39A           ----------------------------------------------------------------------
3cinA           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
1bpoA           IGFSTLTMESDKFICIREKVGEQAQV------VIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTL
1d2nA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2dwuA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
2dhrA           GGNDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALL----------RPGRFDRQIAIDAPDVK
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2cvxA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
2dhrB           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2dhrD           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3c3bA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3eihA           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
3ckdC           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2bbwA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
3e2eA           ----------------------------------------------------------------------
2efcA           ------------------------------------------------EFFSKMEAAFRAHPLWSGCSEE
2ce7D           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
2ak3B           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
1d2mA           GKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREY--RARNLVVRVLLERLNDI
1e2hB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1eaqA           ------IAFKVVALGDVPDG------------TLVTVAGNDEN--YSAELRNATAAK-NQVARFNDLRFV
1ckeA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
1do2A           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1e94E           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1dooE           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
2dlaB           ERIRVVKNEKMDLAQFYALLGALSYSPYGIELELV----KKANLIIYSERLKRKKEIKPEEISIDVSTAI
1bofA           ----------------------------------------------------------------------
3cfuA           LSYVIPKGEQKHYTLVYNPFLADTSNTEERVKDDIDYLVKL-----------------------------
1d0sA           ----------------------------------------------------------------------
1do0A           ----------ASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
3c7zA           ----------------------------------------------------------------------
3c3bB           ----------------------------------------------------------------------
1bpoB           QIFNIEMMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAK
3cf1B           DLEFLAKMTNGEICQRACKLAIRESIESEIVPEIRRDHFEEAMFARRSVSDNDIRKYEMFAQTL------
3c39A           ----------------------------------------------------------------------
3cinA           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
1bpoA           QIFNIE----------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2dwuA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
2dhrA           GREQILR---------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2cvxA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
2dhrB           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2dhrD           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3c3bA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3eihA           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
3ckdC           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2bbwA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
3e2eA           ----------------------------------------------------------------------
2efcA           ELDSAGD----GLEKYVMTKLFTRVFASNTEEVIADEKLFQKM-----SLVQQFISPENLDIQPTFQNES
2ce7D           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
2ak3B           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
1d2mA           DLSPGRFRAKGEVLEIF-----PAYETEPIRVELGFVLFP------------------------------
1e2hB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1eaqA           GRSGRGKS----FTLTI---------TVFTNPPQVATYHRAI----------------------------
1ckeA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL
1do2A           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1e94E           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1dooE           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
2dlaB           EFPTEDVRKIERVYGKIPEYTMKISDFLDLVPDEK
1bofA           -----------------------------------
3cfuA           -----------------------------------
1d0sA           -----------------------------------
1do0A           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
3c7zA           -----------------------------------
3c3bB           -----------------------------------
1bpoB           QKWLLL-----------------------------
3cf1B           -----------------------------------
3c39A           -----------------------------------
3cinA           -----------------------------------
3cf2A           -----------------------------------
2c9oB           -----------------------------------
3cf0A           -----------------------------------
1bpoA           -----------------------------------
1d2nA           -----------------------------------
2c99A           -----------------------------------
2dwuA           -----------------------------------
3ec2A           -----------------------------------
3bosA           -----------------------------------
2dhrA           -----------------------------------
3d8bB           -----------------------------------
3d8bA           -----------------------------------
2cvxA           -----------------------------------
3bosB           -----------------------------------
2dhrB           -----------------------------------
1a5tA           -----------------------------------
2c96A           -----------------------------------
2c98A           -----------------------------------
3b9pA           -----------------------------------
3co5A           -----------------------------------
2chqA           -----------------------------------
1e9sK           -----------------------------------
2dhrF           -----------------------------------
3eihB           -----------------------------------
1e9rB           -----------------------------------
3eccA           -----------------------------------
1eg7A           -----------------------------------
2dhrD           -----------------------------------
1e9sM           -----------------------------------
1eg7B           -----------------------------------
2chgA           -----------------------------------
3c3bA           -----------------------------------
3crmA           -----------------------------------
1e9sL           -----------------------------------
1e9sE           -----------------------------------
1e9sA           -----------------------------------
3eihA           -----------------------------------
2c9cA           -----------------------------------
2dwuB           -----------------------------------
3ckdC           -----------------------------------
2bwjE           -----------------------------------
1e2jB           -----------------------------------
2azpA           -----------------------------------
1e9sB           -----------------------------------
3cmuA           -----------------------------------
1e9sH           -----------------------------------
2bwjD           -----------------------------------
3co5B           -----------------------------------
3cmwA           -----------------------------------
2bjvA           -----------------------------------
1e9rG           -----------------------------------
2bjwA           -----------------------------------
1e9sI           -----------------------------------
1e9rF           -----------------------------------
2ak3A           -----------------------------------
2chgB           -----------------------------------
1e2lB           -----------------------------------
2ce7B           -----------------------------------
1akyA           -----------------------------------
2cdnA           -----------------------------------
2bwjF           -----------------------------------
2ce7C           -----------------------------------
3czpA           -----------------------------------
1e9sJ           -----------------------------------
2c95B           -----------------------------------
1e32A           -----------------------------------
1e2hA           -----------------------------------
2bbwA           -----------------------------------
2chgC           -----------------------------------
2ce7A           -----------------------------------
3d3xB           -----------------------------------
3e2eA           -----------------------------------
2efcA           SWLLAQKELQKINMYKPRDKLVCILN---------
2ce7D           -----------------------------------
3akyA           -----------------------------------
2ak3B           -----------------------------------
2bwjC           -----------------------------------
1b1cA           -----------------------------------
3dkvA           -----------------------------------
1dekB           -----------------------------------
1e2nA           -----------------------------------
2bwjA           -----------------------------------
1e9sF           -----------------------------------
2ce7F           -----------------------------------
1d2mA           -----------------------------------
1e2hB           -----------------------------------
3czpB           -----------------------------------
1eaqA           -----------------------------------
1ckeA           -----------------------------------