[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31135.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dxjF.bssp"
#ERROR : Can't open dsspfile "1aw8E.bssp"
#ERROR : Can't open dsspfile "3blvH.bssp"
#ERROR : Can't open dsspfile "1a41A.bssp"
#ERROR : Can't open dsspfile "1aw8B.bssp"
#ERROR : Can't open dsspfile "1b5dA.bssp"
#ERROR : Can't open dsspfile "1b5eA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"

## Summary of PDB Search
:292
    4e-27  22%  3dxjF  [x.x.x] RNA POLYMERASE PRICIPAL SIGMA FACTOR (RPOD)
    2e-20  12%  1aw8E  [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE
    8e-20  10%  3blvH  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    3e-18  12%  1a41A  [x.x.x] TOPOISOMERASE I
    4e-17  11%  1aw8B  [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE
    2e-06  13%  1b5dA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    2e-05  13%  1b5eA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    3e-04  13%  2c9gA  [x.x.x] PENTON PROTEIN
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
3dxjF           ---------------------LDPKTVEEIDQKLKSLPKEHKRYLHIAR--EGEAARQHLIEANLRLVVS
1aw8E           ----------------------------------------------------------------------
3blvH           ------------------------------------------PLATPIGRSLNLTLRKTFGLANVRPAKS
1a41A           ------------------------MFFKENETVGLLTLKNKHEISPVIKFVGKDKVSHEFVVHKSNRLYK
1aw8B           ----------------------------------------------------------------------
1b5dA           ---------------------------------------------------------------------L
1b5eA           ---------------------------------------------------------------------L
2c9gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
3dxjF           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVET
1aw8E           ------------QDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS-VNGAAAHCASVGDIVI
3blvH           IEGFKTTYENVDLVLIRENTEGEYSGIEHIVPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHK
1a41A           PLLKLTDDSSPEEFLFKLSERKVYECIKQFGIRIK-DLRTYGVNYTFLYNFWTNVKSPKKLIALTIKQTA
1aw8B           ------------QDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAHCASVGDIVIIAS
1b5dA           HLGLALKEKDFVVDKTGVKTIEIIGASFVADEPFIFGA--LNDEYIQRELEWYKSKSLFVKDIPTPKIWQ
1b5eA           HLGLALKEKDFVVDKTGVKTIEIIGASFVADEPFIFGA--LNDEYIQRELEWYKSKSLFVKDI-------
2c9gA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLED
3dxjF           INKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKAQEPVSLETP--IGDEKDSFYGDFIPDE
1aw8E           IASFVTMPDEEARTW--RPNVAYFEGDNEMK---------------------------------------
3blvH           ---STIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNL-----------
1a41A           EVVGHTPSISKRAYM--ATTILEMVKDKNFLDVVSKTTFDEF----------------------------
1aw8B           FVTMPDEEARTW-----RPNVAYFEGDNEMK---------------------------------------
1b5dA           QVASSKGEINSNYGWAIWSEDN------------------------------------------------
1b5eA           ----------------------------------------------------------------------
2c9gA           --------------------------------------GGRNSIRY-------SELAPLFDTTRVYLVDN


                         .         .         .         +         .         .         .:280
query           KSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
3dxjF           HLPSPVDAATQSLLSEE----LEKALSKLSEREAMVLKLRKGLIREHTLEEVGAFFGVTRERIRQIENKA
1aw8E           ----------------------------------------------------------------------
3blvH           ----------------------------------------------------------------------
1a41A           ----------------------------------------------------------------------
1aw8B           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
2c9gA           KSTDVASLNYQNDHSNFLTTVIQNDYSPGEASTQTINL--------------------------------


                         .         *         .         .         .         .         +:350
query           LAKLKKAIKNRx
3dxjF           LRKLKYHESRT-
1aw8E           ------------
3blvH           ------------
1a41A           ------------
1aw8B           ------------
1b5dA           ------------
1b5eA           ------------
2c9gA           ------------