[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31158.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bdp-.bssp"
#ERROR : Can't open dsspfile "2bdpA.bssp"
#ERROR : Can't open dsspfile "1d9dA.bssp"
#ERROR : Can't open dsspfile "2e6lA.bssp"
#ERROR : Can't open dsspfile "1d8yA.bssp"
#ERROR : Can't open dsspfile "3cymA.bssp"
#ERROR : Can't open dsspfile "1cmwA.bssp"
#ERROR : Can't open dsspfile "2a1sA.bssp"
#ERROR : Can't open dsspfile "2a1sC.bssp"
#ERROR : Can't open dsspfile "2a1sD.bssp"
#ERROR : Can't open dsspfile "1bgxT.bssp"
#ERROR : Can't open dsspfile "2dgzA.bssp"
#ERROR : Can't open dsspfile "2cprA.bssp"
#ERROR : Can't open dsspfile "2e1eA.bssp"
#ERROR : Can't open dsspfile "1d8bA.bssp"
#ERROR : Can't open dsspfile "2a1rA.bssp"

## Summary of PDB Search
:364
    1e-23  11%  1bdp-  [x.x.x] DNA POLYMERASE I
    2e-21  10%  2bdpA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)
    6e-21  18%  1d9dA  [c.55.3 - e.8.1] DNA POLYMERASE I
    4e-20  16%  2e6lA  [x.x.x] WERNER SYNDROME ATP-DEPENDENT HELICASE HOMOLOG
    2e-18  17%  1d8yA  [c.55.3 - e.8.1] DNA POLYMERASE I
    2e-15  18%  3cymA  [x.x.x] UNCHARACTERIZED PROTEIN BAD_0989
    1e-13  13%  1cmwA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE
    2e-12  14%  2a1sA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    2e-12  16%  2a1sC  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    3e-12  16%  2a1sD  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-12  11%  1bgxT  [c.120.1 - a.60.7 - c.55.3 - e.8.1] TAQ DNA POLYMERASE
    6e-10  19%  2dgzA  [x.x.x] WERNER SYNDROME PROTEIN VARIANT
    4e-08  17%  2cprA  [x.x.x] EXOSOME COMPONENT 10
    6e-07  20%  2e1eA  [x.x.x] WERNER SYNDROME ATP-DEPENDENT HELICASE
    7e-06  19%  1d8bA  [a.60.8] SGS1 RECQ HELICASE
    3e-05  15%  2a1rA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
1bdp-           ----MAFTLADRVTEEMLADKAALVLEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDE
2bdpA           ----MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDE
1d9dA           -TILDEETLKAWIAKLEKAPVFAFDTETDSLDNISANLVGLSFAIEPGVAAYIPVRERALELLKPLLEDE
2e6lA           -YSYEASDCSFLSEDISDGDVVGFDMEWPPP-GKRSRVAVIQLCVSESKCYLFHISSMSVQGLKMLLENK
1d8yA           -TILDEETLKAWIAKLEKAPVFAFATATDSLDNISANLVGLSFAIEPGVAAYIPSRERALELLKPLLEDE
3cymA           -VIDTLPAFRDYCSLASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGNDFNRAVG
1cmwA           -----------------------------------PEGAFVGLSRKEPMWLAAARGGRVHRAPEPYKALR
2a1sA           -----------------------------------------------------------FSRVIHAIANS
2a1sC           ---------------LEPCTGFQRKLIYQTLSWKYPKGIHVELETEKKERYIVISKVDEFSRVIHAIANS
2a1sD           -----------------------------------------------------------FSRVIHAIANS
1bgxT           ---------------EFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWLAAARGGRVHRAPEPYKALR
2dgzA           ----------------------------------------------------------------------
2cprA           ----------------------------------------------------------------------
2e1eA           ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
2a1rA           ----------------------------------------------------------GFSRVIHAIANS


                         .         .         *         .         .         .         .:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSXXXXXXXXXXXXXXXXSQFSDWRNRP
1bdp-           TKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAGAKRAVP
2bdpA           TKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDVRAAAKMKQYEAVRPDEAVYGKRAVP
1d9dA           KALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRDMDSLAERWLKHKTITFEEIAGKGKNQ
2e6lA           SIKKAGVGIEGDQWKLLRDFDVKLESFVELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDRCSNWSNFP
1d8yA           KALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRDMDSLAERWLKHKTITFEEIAGKGNQI
3cymA           DAVWILHDSLQDLPGFDELGMEPQRLFDTEIAA--RLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRP
1cmwA           DLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP--------------------SNTTPEGVARR
2a1sA           GKLVIGHNMLLDVMHTVHQFTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEG
2a1sC           GKLVIGHNMLLDVMHTVHQFTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEG
2a1sD           GKLVIGHNMLLDVMHTVHQFTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEG
1bgxT           DLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP-------------------SNTTPEGVARRY
2dgzA           ----------------------------------------------------------------------
2cprA           ----------------------------------------------------------------------
2e1eA           ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
2a1rA           GKLVIGHNMLLDVMHTVHQFYCPLPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEG


                         +         .         .         .         .         *         .:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQR
1bdp-           DEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSIAEMEFAGVKVDTKRLEQMGKELRE
2bdpA           DEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSIAEMEFAGVKVDTKRLEQMGKELAE
1d9dA           LTEEAGRYAAEDADVTLQLHLKMWPDLQKHKLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTL
2e6lA           LTEDQKLYAATDAYAGLIIYQKL-----------------------------------------------
1d8yA           ALEEAGRYAAEDADVTLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDVLHNHSEELTL
3cymA           LPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLKEHLIPWMHVSHITEVMRDRQA
1cmwA           YGGEWTEEAGERAALSERLFANLSAVLAHMEATGVLDVAYLRALSLEVALEAEVFRLAGHPFNLNSRDQL
2a1sA           FPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPHVSARSKLIEPF-FNKLFLMRVM-------------
2a1sC           FPSYQLHEAGYDAYITGLCFISMANYLGS---FLSPPKIHVSARSKLIEPFFNKLFLM------------
2a1sD           FPSYQLHEAGYDAYITGLCFISMANYLGSPKIHVSARSKLIEPFF-------------------------
1bgxT           G-GEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREV------------------------------
2dgzA           ----------------------------------------------------------------------
2cprA           ---------------------------------------------------DESYLELYRKQKKHLNTQQ
2e1eA           -------------------------------------------------------------VISAQEQET
1d8bA           ----------------------------------------------------------------------
2a1rA           FPSYQLHEAGYDAYITGLCFISMANYLGSFLSPKIHVSARSKLIEPFFN---------------------


                         .         .         .         +         .         .         .:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
1bdp-           KLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKLAPYHEIVENILHYRQLGKLQS
2bdpA           QLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPV---------------------------------
1d9dA           RLAELEKKAHEIAGEEFNLSSTKQLQTILFEKQGIKPL--------------------------------
2e6lA           ----------------------------------------------------------------------
1d8yA           RLAELEKKAHEIAGEEFNLSSTKQLQTILFEKQGIKPLKK------------------------------
3cymA           LAIVRATRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQ---------
1cmwA           ERVL------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2dgzA           ----LVEARQKHANKMDVPPAILATNKILVDMAKMRPTTIDGVSEGKAAMLAPLWE-----VIKHFCQTN
2cprA           LTAFLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEP-----QGIIACPPLVRQEMHLLIQQAREMP
2e1eA           QIVLLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTV------------------------------
1d8bA           ----LRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMND------------------------------
2a1rA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QVTLEQTSGSKLSTELNDKIIDFFDTYTKQLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bdp-           TYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS--------------------------------------
2bdpA           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2dgzA           SVQTDLFSSTK-----------------------------------------------------------
2cprA           LLKSEVAAGVK-----------------------------------------------------------
2e1eA           ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
2a1rA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
1bdp-           --------------
2bdpA           --------------
1d9dA           --------------
2e6lA           --------------
1d8yA           --------------
3cymA           --------------
1cmwA           --------------
2a1sA           --------------
2a1sC           --------------
2a1sD           --------------
1bgxT           --------------
2dgzA           --------------
2cprA           --------------
2e1eA           --------------
1d8bA           --------------
2a1rA           --------------