[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31166.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ddoC.bssp"
#ERROR : Can't open dsspfile "3dpsF.bssp"
#ERROR : Can't open dsspfile "3ddoB.bssp"
#ERROR : Can't open dsspfile "2ac7B.bssp"
#ERROR : Can't open dsspfile "1a69C.bssp"
#ERROR : Can't open dsspfile "3ddoF.bssp"
#ERROR : Can't open dsspfile "3ddoA.bssp"
#ERROR : Can't open dsspfile "2ac7A.bssp"
#ERROR : Can't open dsspfile "3c74F.bssp"
#ERROR : Can't open dsspfile "3bl6A.bssp"
#ERROR : Can't open dsspfile "2a8yA.bssp"
#ERROR : Can't open dsspfile "3dp9C.bssp"
#ERROR : Can't open dsspfile "2bsxA.bssp"
#ERROR : Can't open dsspfile "3dp9A.bssp"
#ERROR : Can't open dsspfile "1a9qA.bssp"
#ERROR : Can't open dsspfile "3df9A.bssp"
#ERROR : Can't open dsspfile "3df9B.bssp"
#ERROR : Can't open dsspfile "3bgsA.bssp"
#ERROR : Can't open dsspfile "3eeiA.bssp"
#ERROR : Can't open dsspfile "3bsfA.bssp"
#ERROR : Can't open dsspfile "3ddoE.bssp"
#ERROR : Can't open dsspfile "2ai3A.bssp"
#ERROR : Can't open dsspfile "3e0qA.bssp"
#ERROR : Can't open dsspfile "3c74E.bssp"
#ERROR : Can't open dsspfile "2a0xA.bssp"
#ERROR : Can't open dsspfile "2ai2A.bssp"
#ERROR : Can't open dsspfile "3c74A.bssp"
#ERROR : Can't open dsspfile "2a0wA.bssp"
#ERROR : Can't open dsspfile "2a0yA.bssp"
#ERROR : Can't open dsspfile "1b8oA.bssp"
#ERROR : Can't open dsspfile "3e9rB.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "1b8nA.bssp"
#ERROR : Can't open dsspfile "3djfB.bssp"
#ERROR : Can't open dsspfile "2b94A.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "3e9zC.bssp"
#ERROR : Can't open dsspfile "1c3xA.bssp"

## Summary of PDB Search
:240
    1e-31  16%  3ddoC  [x.x.x] URIDINE PHOSPHORYLASE
    1e-30  16%  3dpsF  [x.x.x] URIDINE PHOSPHORYLASE
    2e-29  17%  3ddoB  [x.x.x] URIDINE PHOSPHORYLASE
    4e-29  32%  2ac7B  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    7e-29  32%  1a69C  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    6e-28  17%  3ddoF  [x.x.x] URIDINE PHOSPHORYLASE
    5e-26  16%  3ddoA  [x.x.x] URIDINE PHOSPHORYLASE
    3e-25  32%  2ac7A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-25  16%  3c74F  [x.x.x] URIDINE PHOSPHORYLASE
    7e-24  16%  3bl6A  [x.x.x] 5'-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    9e-24  15%  2a8yA  [x.x.x] 5'-METHYLTHIOADENOSINE PHOSPHORYLASE (MTAP)
    1e-23  16%  3dp9C  [x.x.x] MTA/SAH NUCLEOSIDASE
    3e-23  18%  2bsxA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-23  16%  3dp9A  [x.x.x] MTA/SAH NUCLEOSIDASE
    1e-22  10%  1a9qA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-22  16%  3df9A  [c.56.2 (1nc1A)] MTA/SAH NUCLEOSIDASE
    5e-22  15%  3df9B  [c.56.2 (1nc1B)] MTA/SAH NUCLEOSIDASE
    8e-22  10%  3bgsA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    9e-22  13%  3eeiA  [x.x.x] 5-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    1e-21  13%  3bsfA  [x.x.x] AT4G34840
    1e-21  16%  3ddoE  [x.x.x] URIDINE PHOSPHORYLASE
    5e-21   8%  2ai3A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-20  11%  3e0qA  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    3e-20  16%  3c74E  [x.x.x] URIDINE PHOSPHORYLASE
    3e-20  10%  2a0xA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    6e-20  11%  2ai2A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    8e-20  17%  3c74A  [x.x.x] URIDINE PHOSPHORYLASE
    4e-19  11%  2a0wA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-18  11%  2a0yA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-18  10%  1b8oA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-18  12%  3e9rB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    1e-17  14%  1cb0A  [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    1e-15  11%  1a9oA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-14  12%  1b8nA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-13  15%  3djfB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    8e-08  17%  2b94A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-06  30%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    8e-05  14%  3e9zC  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    1e-04   9%  1c3xA  [c.56.2] PENTOSYLTRANSFERASE
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYXXXXXXXXXXXXXX
3ddoC           ------HLG-LTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
3dpsF           ------HLG-LTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
3ddoB           ------HLG-LTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
2ac7B           ----SVHIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
1a69C           ----TPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
3ddoF           ------HLG-LTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
3ddoA           ------HLG-LTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
2ac7A           ----SVHIE-AKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
3c74F           ----VFHLG-LTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
3bl6A           ----------------MMIGIIGAMEEEVTILKN-KLTQLSEIS-VAHVKFYTGILKDREVVITQSGIGK
2a8yA           -----------EQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPYQPSDFITIGKIGNKSVAFLPRHGRG
3dp9C           -----------------KIGIIGAMQQEVAILKD-LIEDVQEVN-QAGCTFYSGQIQGVDVVLLQSGIGK
2bsxA           ----LRHLKI-SKEQITPVVLVVGDPGRVDKIKV-VCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGS
3dp9A           -----------------KIGIIGAMQQEVAILKD-LIEDVQEVN-QAGCTFYSGQIQGVDVVLLQSGIGK
1a9qA           ----AKWLLS-HTEQRPQVAVICGSGLGGLVNKSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHM
3df9A           -----------------KIGIIGAMEEEVTLLRDKIEN--RQTISLGGCEIYTGQLNGTEVALLKSGIGK
3df9B           -----------------KIGIIGAMEEEVTLLRDKIEN--RQTISLGGCEIYTGQLNGTEVALLKSGIGK
3bgsA           ----AEWLL-SHTKHRPQVAIICGTQAQIFDYSEIP-NFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHM
3eeiA           ---------------LKTVAVIGAMEQEIELLREMMEN--VKAVSFGRFSAYEGELAGKRMVLALSGIGK
3bsfA           ----------------STIVFIVAMQKEAQPLIN-RLRLVEEVNTPFKDLNINIVCPGKDSTLGVESVGT
3ddoE           ------HLG-LTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
2ai3A           YQDTAKWLLS-HTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGR
3e0qA           ----AHHIQK-LTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTIFGTLSGRKVVVMQGRFHM
3c74E           ------HLG-LTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
2a0xA           ----AEWLLS-HTKHRPQVAIICGTQAQIFDYSEIPNFPRSTVPGHAGRL-VFGFLNGRACVMMQGRFHM
2ai2A           YQDTAKWLLS-HTEQRPQVAVICGSGLGG---LVNKLTQAQTFDYSEIPNFVFGILNGRACVMMQGRFHM
3c74A           ------HLG-LTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGG
2a0wA           ----AEWLLS-HTKHRPQVAIICGSGLAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHM
2a0yA           ----AEWLLS-HTKHRPQVAIICGSGLGGIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHM
1b8oA           -----------HTEQRPQVAVICGSGLGQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHM
3e9rB           ----AHHIQK-LTSIVPEIGIICGSGLGKLADGVKDKITIPNFPQTSSGNLIFGTLSGRKVVVMQGRFHM
1cb0A           -----------------KIGIIGGTGLDDPEILEGRTEKYVDPFGKPSDALILGKIKNVDCVLLARHGRQ
1a9oA           -----------HTEQRPQVAVICGSGLGQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHM
1b8nA           ----------------------------------------------------------------------
3djfB           ----------------------------------------------------------------------
2b94A           ----------LTPSQTTPVVLVVGDPGRVDKVKML----CDSYVDLAEYKSVECTYKGQKFLCVSHGVGS
3bjeA           ----TLHLK-CKSDELADRIIFVGDPGRVDVISGYFDKDSIR----------------------------
3e9zC           ----------------------------------------------------------------------
1c3xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
3ddoC           PSTSIAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVL-VTTASVRLDGASLHFAPMEFPAVADFACTTA
3dpsF           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVL-VTTASVRLDGASLHFAPMEFPAVADFACTTA
3ddoB           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVLVTTASVRDGASLHFAPMEFPAV--ADFACTTA
2ac7B           PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
1a69C           PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
3ddoF           PSTSIAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVL-VTTASVRLDGASLHFAPMEFPAVADFACTTA
3ddoA           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVLVTTA-SVRLDGASLHFAPMEFPAVADFACTTA
2ac7A           PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
3c74F           PSTSIAVEELAQLG-IRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAV-ADFACTTA
3bl6A           VNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHFGYEYGQIPQMPVAFQSSKPLIEK
2a8yA           HRIPPHNIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTFFDGPVVAHVSMADPFCNSLRKL
3dp9C           VSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDAYEIGQMAGQPAAFKADEKLMTV
2bsxA           AGCAVCFEELCQN-GAKVIIRAGSCGSLQPDIKRGDICICNAAVREDRVSHLLIHGDFPAV-GDFDVYDT
3dp9A           VSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDAYEIGQMAGQPAAFKADEKLMTV
1a9qA           YEGYTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPNEERFGVRFPAMSDAYDRDMRQK
3df9A           VAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFEYGQLPGCPAGFKADDK
3df9B           VAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFEYGQLPGCPAGFKADDK
3bgsA           YEGYTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSRFGDRFPAMSDAYDRTMRQR
3eeiA           VNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHAFGYAWGQVPQLPARFASDGILIEA
3bsfA           VPASLVTYASILAIQPDLIINAGTAGGFKAKACISDVYVVSTVAFHDRRIPV-----PVLDIYGVGMRNT
3ddoE           PSTSIAVEEL-AQLGIRTFLRIGTTGAIQPHINVGDVLVT-TASVRLDGASLHFAPMEFPAVADFACTTA
2ai3A           FHMYEFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSRFGVRFPAMSDAYDRDMRQK
3e0qA           YEGYSNDTRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYGPNQEAFGTRFPALSNAYDRDLRKL
3c74E           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVLVT-TASVRLDGASLHFAPMEFPAVADFACTTA
2a0xA           YEGYTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHLRGPNDERFGDRFPAMSDAYDRTMRQR
2ai2A           YEGYTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFDRDMRQK
3c74A           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADF-ACTTA
2a0wA           YEGYTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDTMRQR
2a0yA           YEGYTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFDRTMRQR
1b8oA           YEGYPFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHLRGPNEERFGVRFPAMSDAYDRDMRQK
3e9rB           YEGYNDTVRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPNQEAFGTRFPALSNAYDRDLRKL
1cb0A           HT--IMPSKALKEEGCTHVIVTTACGSLREEIQPGDIVIIDSFYDGSHSCARGVCHIPMAEPFCPKTREV
1a9oA           YEGYTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERYDRDMRQK
1b8nA           ----TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFDRDMRQK
3djfB           --------RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHLVGPNQEAFGTRFPALSNAYDRDLRKL
2b94A           AGCAICFEEL-MNNGAKVIIRAGSCGSLQPTMKRGDICICNAAVRED-RVSHLMIYSDFPAVADFEVYDT
3bjeA           ----------------------------------------------------------------------
3e9zC           ----------MKLLGVKILMVSNAAGGLNRSLKLGDFVIL------KDHIYLPGLGLNNVGPNQEAFGTR
1c3xA           ----VHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEGPTFVDLTDVYSPR-LR


                         +         .         .         .         .         *         .:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMXXXXXXXXXXXXGKKASAVVTISDS
3ddoC           LVEAAKSIGATTHVGVTASSDTFYPGQERYSGRVVRRFKGSMYEMESATLLTMCASQGLRAG---MVAGV
3dpsF           LVEAAKSIGATTHVGVTASSDTFY---PGQSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV-
3ddoB           LVEAAKSIGATTHVGVTASSDTFYPRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
2ac7B           AYDAGTEKGLHVRVGNVLTADVFY-RESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSD-
1a69C           AVDAAKALGIDARVGNLFSADLFY-SPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
3ddoF           LVEAAKSIGATTHVGVTASSDTFYPGQERYSGRVVRRFKGSMYEMESATLLTMCASQGLRAGMVAGVIVN
3ddoA           LVEAAKSIGATTHVGVTASSDTFYVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
2ac7A           AYDAGTEKGLHVRVGNVLTADVFY-RESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSD-
3c74F           LVEAAKSIGATTHVGVTASSDTFYVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
3bl6A           VSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDL
2a8yA           AIETAKELNIKTHESGTYICIEGPRFSTRAESRTWEVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDY
3dp9C           AEQALAQLPNTHVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDV
2bsxA           LNKCAQELNVPVFNGISVSSDMYYPNKIISRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGC
3dp9A           AEQALAQLPNTHVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDV
1a9qA           AHSTWKQMGEELQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3df9A           LIAAAEACIAELVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDV
3df9B           LIAAAEELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDV
3bgsA           ALSTWKQMGEELQEGTYVMVAGPS-FETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3eeiA           AKRAARTFEGAAVEGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDS
3bsfA           FPTPNLIKELNLKVGRLSTGDSMDM--SPHDEESITANDATVKDMEGAAVAYVADIFKVPTILIKGVTDI
3ddoE           LVEAAKSIGATTHVGVTASSDTFYVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV-
2ai3A           AHSTWKQMGEQLQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3e0qA           AVQVAEENGFGVHQGVYVMNGGPC-YETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNI
3c74E           LVEAAKSIGATTHVGVTASSDTFYVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
2a0xA           ALSTWKQMGEQLQEGTYVMVAGPSF-ETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
2ai2A           AHSTWKQMGEQLQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3c74A           LVEAAKSIGATTHVGVTASSDTFYVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV-
2a0wA           ALSTWKQMGEQLQEGTYVMVAGPSF-ETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
2a0yA           ALSTWKQMGEQRELQEGVMVAGPS-FETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
1b8oA           AHSTWKQMGEQLQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3e9rB           AVQVAEENGFGVHQGVYVMNGGPC-YETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNI
1cb0A           LIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDY
1a9oA           AHSTWKQMGEQLQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
1b8nA           AHSTWKQMGEQLQEGTYVMLGGPN-FETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
3djfB           AVQVAEENGFGNLVHQVMNGGPCY--ETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNI
2b94A           LNKVAQELEVPVFNGISLSSDLYYHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGC
3bjeA           ----------------------------------------------------------------------
3e9zC           FPALSNAYDRDLRKAEENGFGNLVHQETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTND
1c3xA           ELAHRVDPTLPEGVYAQFPGPHYETPAEVRMAGI---LGADLVGMSTTLEAIAARHCGLEVLGVSLVTNA


                         .         .         .         +         .         .         .:280
query           FITGESTTAQQREQSFTNMMEVALGTIKEN
3ddoC           IVNRTQQNAETMKQTESHAVKIVVEAAR--
3dpsF           -------NRTQEKQTESHAVKIVVEAAR--
3ddoB           RTQQEIPTESHAVKIVVEAARRLL------
2ac7B           ------------------------------
1a69C           IRTTA----AERQTTFNDMIKIAL------
3ddoF           RTQQEIPNASHAVKIV--------------
3ddoA           RTQKQTSHA---------------------
2ac7A           ------------------------------
3c74F           RTQQEIPNAETMK--ESHAVKIVVEAARR-
3bl6A           ANGEAEMSFEALEKAAVSSSQTVEALVSQ-
2a8yA           DVAEIPVTAEEVTRVMAENTEKAKKLLYA-
3dp9C           ADKESPLSFEEFPLAAKSSSAMVLKMVEL-
2bsxA           PFKWDELVP----HQLENMIKIALGACAK-
3dp9A           ADKESPLSFEEFPLAAKSSSAMVLKMVEL-
1a9qA           VIMDTESQGKANHEEVLEAGKQAAQKLEQ-
3df9A           ADQQSHLSFDEFLAVAAKQSSLMVESLVQK
3df9B           ADQQSHLSFDEFLAVAAKQSSLMVESLVQK
3bgsA           VIMDYESLEKANHEEVLAAGKQAAQKLEQ-
3eeiA           ADEKADISFDELKTAAANSAKMVAEIVKS-
3bsfA           VDGNRPTSEEFLENLAAVTAKLDESLTK--
3ddoE           -------NRTQQKQTESHAVKIVVEAAR--
2ai3A           VIMDYKANHEEVLEAGKQAAQKLEQFVSL-
3e0qA           SVLDVESDLKPNHEEVLATGAQRAELMQS-
3c74E           RTQQEIPSHAVKIV----------------
2a0xA           VIMDYESLEKANFEEVLAAGKQAAQKLEQ-
2ai2A           VIMDYESQGKANHEEVLEAGKQAAQKLEQ-
3c74A           -------NRTQQEIPESHAVKIVVEAARR-
2a0wA           VIMDYESLEKANGEEVLAAGKQAAQKLEQ-
2a0yA           VIMDYESLEKANDEEVLAAGKQAAQKLEQ-
1b8oA           VIMDYESQGKANHEEVLEAGKQAAQKLEQ-
3e9rB           SVLDVEEEVLATGAQRALMQSWFEKIIEK-
1cb0A           --DCWAVSVDRVLKTLKENANKAKSLLLT-
1a9oA           VIMDTE---SQGKANHEEVLEAGK------
1b8nA           VIMDYESQGKANHEEVLEAGKQAAQKLEQ-
3djfB           SVLDVEQRAELMQSWFEKIIEKLP------
2b94A           PLKWN-----LVPEKLENMIKIS-------
3bjeA           ------------------------------
3e9zC           VESDLKPNHEEVLATGAQRAELMQSWFEK-
1c3xA           GISPTPLSHAEVIEAGQAAGPRISALLAD-