[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31313.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c48B.bssp"
#ERROR : Can't open dsspfile "3c4qB.bssp"
#ERROR : Can't open dsspfile "3c48A.bssp"
#ERROR : Can't open dsspfile "3beoA.bssp"
#ERROR : Can't open dsspfile "3c4qA.bssp"
#ERROR : Can't open dsspfile "2bisA.bssp"
#ERROR : Can't open dsspfile "3dzcA.bssp"
#ERROR : Can't open dsspfile "2acvA.bssp"
#ERROR : Can't open dsspfile "3d1jA.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "3copA.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "3cuyA.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "2bgtA.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "3cv3A.bssp"
#ERROR : Can't open dsspfile "2bfwA.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "2acvB.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "2bguA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3bjxB.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "3d0rA.bssp"
#ERROR : Can't open dsspfile "2c1xA.bssp"
#ERROR : Can't open dsspfile "2c9zA.bssp"
#ERROR : Can't open dsspfile "3bjxD.bssp"
#ERROR : Can't open dsspfile "1bc9A.bssp"
#ERROR : Can't open dsspfile "2c1zA.bssp"
#ERROR : Can't open dsspfile "3d0rB.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "1dvgA.bssp"

## Summary of PDB Search
:366
    1e-28  13%  3c48B  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    9e-28  13%  3c4qB  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    4e-27  11%  3c48A  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    5e-27  10%  3beoA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    1e-24  12%  3c4qA  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    1e-23  16%  2bisA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    2e-22   8%  3dzcA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    2e-21  15%  2acvA  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    4e-20  11%  3d1jA  [x.x.x] GLYCOGEN SYNTHASE
    1e-19  13%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    4e-19   9%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-18  11%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-18  12%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    3e-18  10%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-18  11%  3copA  [x.x.x] GLYCOGEN SYNTHASE
    6e-18   8%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-17   9%  1c3jA  [c.87.1] BETA-GLUCOSYLTRANSFERASE
    1e-17  11%  3cuyA  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    2e-17  10%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-17   8%  2bgtA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    5e-17  10%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    5e-17  11%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    8e-17  14%  3cv3A  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    2e-16  21%  2bfwA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    3e-16  10%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    4e-16   9%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-16   8%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-16  13%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    5e-16   8%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-16  11%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    7e-16  11%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-15  11%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-15   9%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-15  12%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-15  12%  2acvB  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    2e-15  12%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-15  10%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    2e-15  11%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    6e-15   8%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-14   7%  2bguA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    2e-13  10%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    5e-13  12%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-11  11%  3bjxB  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    3e-11   9%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    7e-11  13%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    5e-10   7%  3d0rA  [x.x.x] PROTEIN CALG3
    2e-09  10%  2c1xA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    5e-09  11%  2c9zA  [x.x.x] UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
    2e-08  10%  3bjxD  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    3e-08  15%  1bc9A  [x.x.x] CYTOHESIN-1
    4e-08   9%  2c1zA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    5e-08   8%  3d0rB  [x.x.x] PROTEIN CALG3
    2e-07  14%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    2e-07  14%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    4e-04  11%  1dvgA  [a.132.1] HEME OXYGENASE-1
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXXXXXXXXXXX
3c48B           ---MISMHTSPLQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGIVRVAENLRVINIAAGPYEGLSKE
3c4qB           ---PLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRAENLRVINIAAGPYEGLSKE
3c48A           ---MISMHTSPLQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSK
3beoA           MTERLKVMTIFGTRPEAIKMAPLVLELQKHPEKIESIVTVTAQHRQMLDQVLSIFGKDRQTLIDITTRGL
3c4qA           ---PLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRAENLRVINIAAGPYEGLSKE
2bisA           ----------------------------------------------------------------------
3dzcA           ------VLIVFGTRPEAIKMAPLVQQLCQDNRFVAKVCVTGQHREMLDQVLELFSITPDFDLNIMEPGQT
2acvA           ----------------------------------------------------------------------
3d1jA           ----------------------------------------------------------------------
2c4mA           ----------------------------------------------------------------------
3e3lA           -KTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKR
2atiA           ----------------------------------------------------------------------
2c4mC           ----------------------------------------------------------------------
3e3nE           ----------------------------------------------------------------------
3copA           ----------------------------------------------------------------------
3e3oD           LVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLET------LLPRHLQIIYEINQRFLNRVAA
1c3jA           ---------------------------------------------KIAIINMGNNVI---NFKTVPSSET
3cuyA           -----------LRGTTRFFSLRGDMRLPLDDTANTVVSHNGVDCYLWRTTVHPFNTRPVEDAMFRWYAAH
3e3oA           LVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
2bgtA           ----------------------------------------------------------------------
1b4dA           VKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKR
1e1yA           ----------------------------------------------------------------------
3cv3A           ----------------------------------------------------------------------
2bfwA           ----------------------------------------------------------------------
3e3oB           -KTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKR
3e3lB           -------------EVTVKTCAYTNHTVLPEALERWPVHLLETLLHLQIIYEINQRFLNRVAAAFPGDVDR
3e3oC           ----------------------------------------------------------------------
1e4oA           ----------------------------------------------------------------------
3e3lC           LVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEIRFLNRVAAAFPGDVDR
3cejA           ----------------------------------------------------------------------
3cehA           ----------------------------------------------------------------------
3dd1B           ----------------------------------------------------------------------
3e3lD           -------------EVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3e3nC           ----------------------------------------------------------------------
2acvB           ----------------------------------------------------------------------
3ddsB           ----------------------------------------------------------------------
1a8iA           ----------------------------------------------------------------------
3ddwB           QKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKR
3cuvA           -------------EVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRNRVAAAFPGDVDR
2bguA           ---------------------------------------------KIAIINMGNNVINFKTVPSSETIYL
1c8lA           ----------------------------------------------------------------------
3ddsA           ----------------------------------------------------------------------
3bjxB           ----------------------------------------------------------------------
1bx3A           ----------------------------------------------------------------------
2c4mB           ----------------------------------------------------------------------
3d0rA           ----------------------------------------------------------------------
2c1xA           ----------------------------------------------------------------------
2c9zA           ----------------------------------------------------------------------
3bjxD           ----------------------------------------------------------------------
1bc9A           ----------------------------------------------------------------------
2c1zA           ----------------------------------------------------------------------
3d0rB           ----------------------------------------------------------------------
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
1dvgA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
3c48B           ELPFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTL----AAVKTPESEARRICEQQLVDNA
3c4qB           ELPFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVSDTPESEARRICEQQ---LVDNA
3c48A           EELPTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYDTPESEARRICEQQLVDNA
3beoA           EGLDKVMKEAKPDIVLVHGDTTTTFIASLAAFYNQIPVGHVEAGLRTWDKYSPYPEEMNRQL---TGVMA
3c4qA           ELPTSFTRREKVTYDLIHSHYWLGQVGWLLRDLWRIPLIHTAHTLAAVDTPESEARRICEQQLVDNADVL
2bisA           -----------PDVVHFHDWHTVFAGALIKKYFKISKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIV
3dzcA           LNGQQVLSSEQPDVVLVHGDTATTFAASLAAYYQQIPVGHVEAGLRTGNIYSPWPEEGNRKL---TAALT
2acvA           --------------RQIEEVFDDSDRDHQLLNIPGISNQVPSNVLPDACFNKDGGYIAYYKLAERFRDFS
3d1jA           --FYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITQFAYGMEGLLQQRHRE
2c4mA           --CYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGV-----TPRRWLRMINPGLSDLLTRLSG
3e3lA           INMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERI
2atiA           --NMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKI
2c4mC           --TVHMAWIACYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTR
3e3nE           --RMSLVEEGAVKRINMAHLCIAGSHAVNGRIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCN
3copA           -------QLPWSFFNIHGLEFNGQISFL--KAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHRE
3e3oD           AFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIKDFYELEPHKFQNKTNGITPRRWLVLCN
1c3jA           IYLFKVISEMGLNVDIISLKNGVYTKSFDE-VDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDI
3cuyA           PPKQLLDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVYRAS----AGLSTINVASYIEREFDRVAPTL
3e3oA           DRLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKFYELEPHKFQNKTNGITPRRWLVLCNPGLAEII
2bgtA           ---EVDVNDYDRLIVVNSKPNLAILSAQKFMAKYK-SKIYYLFTDIRLPFSQEEELLIKSPIKVISQGIN
1b4dA           INMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERI
1e1yA           -------KRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFPHKFQNKTNGITPRRWLVLCNPGLAEII
3cv3A           -----LDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVYRAS----AGLSTINVASYIEREFDRVAPTL
2bfwA           ----------------------------------------------------------------------
3e3oB           INMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERI
3e3lB           LRRMSLVEEGAVKRINMCIAGSHAVNGVARIHSEILKEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERI
3e3oC           ----SLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKFKDFYELEPHKFQNKTNGITPRRWLVLCN
1e4oA           --------------LHSDLVVKDLFPEYHQLWPNKFHNV-----------------TNGITPRRWIKQCN
3e3lC           LRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKFKDFYELEPHKFQNKTNGITPRRWLVLCN
3cejA           --NMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKI
3cehA           --INMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEK
3dd1B           --IVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITP------RRWLLLCNPGLAELIAEKI
3e3lD           DRLEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELFQNKTNGITPRRWLVLCNPGLAEII
3e3nC           --AVKRINMAHLCIAGSHAVNRIHSEILKKTIFKDFYELEPHKFNKTNGITPRRWLVLCNPGLAEIIAER
2acvB           --------------RQIEEVFDDSDRDHQLLNIPGISNQVPSNVLPDACFNKDGGYIAYYKLAERFRDFS
3ddsB           --HLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNG---ITPRRWLLLCNPGLAELIAEKI
1a8iA           ------DRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARITIFKDFYELEPHKFQNKTNGITPRRWLV
3ddwB           INMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRW-LLLCNPGLAELIAEKI
3cuvA           LRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTITPRRWLVLCN
2bguA           FKVISE-MGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLL
1c8lA           --HLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGI---TPRRWLVLCNPGLAEIIAERI
3ddsA           -----IVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITP---RRWLLLCNPGLAELIAEKI
3bjxB           ----------------------------------------------------------------------
1bx3A           ---VEEGAVKRINMAHLCIAGSHAVNGVA-RIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCN
2c4mB           --MAWIACYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTRLSG
3d0rA           --TMALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDKHQVSLPEP
2c1xA           -----------------SGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPK-A
2c9zA           ---------------------------------------------------------------------A
3bjxD           ----------------------------------------------------------------------
1bc9A           ----------------------------------------------------------------------
2c1zA           ------IDEIREKIGVSGIQGREDELLNFIPGMS-KVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPK-A
3d0rB           ----ALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDKHQVSLPEP
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
1dvgA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
3c48B           DVLAVNTQEEMQDLMHHYDADPDRISPGADVELYSPGNDRTERSRRELGIPLHTKVVAFVGRLQPFKGPQ
3c4qB           DVLAVNTQEEMQDLMHHYDADPDRISPGADVELYSPGNDRATRSRRELGIPLHTKVVAFVGRLQPFKGPQ
3c48A           DVLAQEEMQDLMHHYDADPDRISVVSPGADVELYSPGTERSRRELGI---PLHTKVVAFVGRLQPFKGPQ
3beoA           DLHFSPTAKSATNLQKENKDESRITGNTAIDALKTTVKETYSHPVLEKLGNNRLVLMTAHRRENLGEPMR
3c4qA           AVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGNDRATRSRRELGIPLHTKVVAFVGRLQPFKGPQ
2bisA           TTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSMDEGVTFMFIGRFDRGQKGVD
3dzcA           QYHFAPTDTSRANLLQENYNAEFVTGNTVIDALLAVREKIHTDMDLQATASKKLILVTGHRRESFGGGFE
2acvA           DLEQSSIYDHDEKIPPIYAVGPLLDLKGQPNPKLDQAQHDLILKWLDEQPDKSV-VFLCFGSMGVSFGPS
3d1jA           GRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLD
2c4mA           SDDWVTDLDELKKLRSYADDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQL
3e3lA           GEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
2atiA           GEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
2c4mC           LSGSDDWVTDLDELKKYADDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQL
3e3nE           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3copA           GRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLD
3e3oD           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
1c3jA           RLPFSQSAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYPTKKTLDVIYGGSFRSGQRES
3cuyA           DVIALVSPAMAAEVVS--RDNVFHVGHGVDHNLDQ---------------LGDPSPYAEGIHAVAVGSML
3e3oA           AGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQEKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
2bgtA           LDIAK--AAHKKVDNVIEFEYFPIEQYKIHMNDFQLS-----------KPTKKTLDVIYGGSFRSGQRES
1b4dA           GEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
1e1yA           AERIGEEYISDLDQLRKLLSDDEAFIRDVAKVKQENKLKFAAYLEYKVHINPNSLFDVQVKRIHEYKRQL
3cv3A           DVIALVSPAMAAEVVS--RDNVFHVGHGVDHNLDQL-----------GDPSPYAEGIHAVAVGSMLFDPE
2bfwA           ---------------------------GIDCSFWNESYLTGSRLLSKFGMDEGVTFMFIGRFDRGQKGVD
3e3oB           GEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3e3lB           GEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3e3oC           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKYLEREYKVHINPNSLFDVQVKRIHEYKRQL
1e4oA           PALAALLDKSLQKEWANDLDQLINLEKFADDAKFRDQYREFVKVRTGIEINPQAIFDIQIKRLHEYKRQH
3e3lC           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3cejA           GEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
3cehA           IGEDYVKDLSQLTLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
3dd1B           GEDYVKDLSQLTKLHSFLGDDLRELAKVKQENKLKFS--QFLETEYKVKINPSSMFDVQVKRIHEYKRQL
3e3lD           AERIGEEYISDLDQLRKLLSYVDDFIRDVAKVKQKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3e3nC           IGEEYISDLDQLRKLLSYVDDEAFIRVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
2acvB           DLEQSSIYDHDEKIPPIYAVGPLLDLKGQPNPKLDQAQHDLILKWLDEQPDKSV-VFLCFGSMGVSFGPS
3ddsB           GEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
1a8iA           LCNPGLAEIIAERIGEEYISDLDKLLSYVDDEAFIRDVAKVKEREYKVHINPNSLFDVQVKRIHEYKRQL
3ddwB           GEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
3cuvA           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFILKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
2bguA           IKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRES
1c8lA           GEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
3ddsA           GEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQL
3bjxB           -----------------------------FPQLSQLDVSGEESTYEDIRLTLRVPWVAFGCRVLATFPG-
1bx3A           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAAYLEREYKVHINPNSLFDVQVKRIHEYKRQL
2c4mB           SDDWVTDLDELKKLRSYADDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQL
3d0rA           VATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPV----------PARPEVAITMGTIELQAFGI
2c1xA           TAVFINSFEELDDSLTNDLKSKLKTYLNIGPF-------NLITGCLQWLKERKPTSVVYISFGTVTTPPP
2c9zA           TAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKER-----KPTSVVYISFGTVTTPPPAE
3bjxD           ------------------------LVPRGSHTNPAYFVSGEESTYEDIRLTLRVPWVAFGCRVLATFPG-
1bc9A           -----------------------------------------------------------MKNMQRNKQVA
2c1zA           TAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKER-----KPTSVVYISFGTVTTPPPAE
3d0rB           VATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPV----------PARPEVAITMGTIELQAFGI
1ahpA           ----------------------------VIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRKRQHLNLL
2ecpA           ----------------------------VIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRKRQHLNLL
1dvgA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
3c48B           VLIKAVAALFDRDPDRNLRVIICGGPSTYRHMAEELGVEKRIRFLDPRPPSEAVYRAADIVAVPSFNESF
3c4qB           VLIKAVAALFDRDPDRNLRVIICGGPYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESF
3c48A           VLIKAVAALFDRDPDRNLRVIICGGPSDTYRHMLGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESF
3beoA           NMFRAIKRLVDKHEDVQVVYPVHMNPVVRETANDILGDYGRIHLIEPL---DVIDFHNVAARSYLMLTDS
3c4qA           VLIKAVAALFDRDPDRNLRVIICGGPTYRHMAEELGVEKRIRFLDPRPPELVAVYRAADIVAVPSFNESF
2bisA           VLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPF
3dzcA           RICQALITTAEQHPECQILYPVHL--NPNVREPVNKLLKGVSNIVLIEPQQYLPFV-YLMDRAHIILTDS
2acvA           QIREIALGLKHSGV--RFLWSNSAEKKVFPEGFLEWMELEGKGMICGWAPQVEVLA--HKAIGGFVSHCG
3d1jA           LVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEFSHRIMGGADVILVPSRFEPC
2c4mA           MNARIKEDGLTDIPARTVIFGAKAAPGYVRAKAIIKLINSLKVVFVENYNVSPAEHILPAQISTAGKEAS
3e3lA           LNCRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMHDPVVGDRLRVIFENYRVSLAEKVIPEQISTAGTEAS
2atiA           LNCLHVITMYKLFVPRTVIIGGLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPEQISTAGTEAS
2c4mC           MNALYVLDLYTDIPARTVIFGAKAAPGYLINSIADLVNNDPEVSPLLKVVFVENYNVSPAQISTAGKEAS
3e3nE           LNCRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
3copA           LVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSRIMGGADVILVPSRFAPC
3e3oD           LNCLHVITLYNRIKK-EPNKFVVPRTVMIGGKAHDPVVGDRLRVIFLENYRVSLAEKVSEQISTAGTEAS
1c3jA           KMVEFLF-----DTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALKNYNDNFI
3cuyA           FDPEFFVVASKAFPQVTFHVIGSGMGR-----HPGYGDNVIVYGEMKHAQTIGYIKHARFGIAPYASEQV
3e3oA           LNCRIKKEPNKFVVPRTVMIGGKAAPGKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
2bgtA           KMVEFLFDT-----GLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALINYNDNFI
1b4dA           LNCRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
1e1yA           LNCLHVKEPNKFVVPRTVMIGGKAAPGYHMAKMIDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
3cv3A           FFVV----ASKAFPQVTFHVIGSGMGR-----HPGYGDNVIVYGEMKHAQTIGYIKHARFGIAPYASEQV
2bfwA           VLLKAIEILSSKKEFMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYDFVIIPSYFEPF
3e3oB           LNCLIKKEPNKFVVPRTVMIGGAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
3e3lB           LNCRIKKEPNKFVVPRTVMIGGKAAPGKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
3e3oC           LNCRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKVNHDPVVGDRLRVIFLENYRVSLAQISTAGTEAS
1e4oA           LNLEIRENPQADRVPRVFLFGAKAAPGYYLAKNIIFAINKLKVVFLPDYCVSAAEKLIPAQISTAGKEAS
3e3lC           LNCRIKKEPNKFVVPRTVMIGGKAMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKSTAGTEAS
3cejA           LNCRIKKDPKKLFVPRTVIIGHMAKMIIKLITSNDPMVGSKLKVIFENYRVSLAEKVIPEQISTAGTEAS
3cehA           LNCLHVITMYKLFVPRTVIIGGKAAPGYHMAKMNDPMVGSKLKVIFRVSLAEKVIPATDLQISTAGTEAS
3dd1B           LNCRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMNDPMVGSKLKVIFLENYRVSLAEKVIEQISTAGTEAS
3e3lD           LNCLHVITLYNRIKKEPVMIGGKAAPGYHMAKMIIKLITALRVIFLENYRVSLAEKVIPEQISTAGTEAS
3e3nC           LNCLHVITPNKFVVPRTVMIGGKAKMIIKLITAIGDVVNHLRVIFLENYRVSLAEKVIPEQISTAGTEAS
2acvB           QIREIALGLKHSGVRFLWSNSAEKKVFPEGFLEWMELEGKGMICGWAPQVEVLA----HKAIGGFVSHCG
3ddsB           LNCRIKKDPKKLFVPRTVIIGGKHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYREQISTAGTEAS
1a8iA           LNCLIKKEPNKFVVPRTVMIGGKAAPGYHMAKMHDPVVGDRLRVIFENYRVSLAEKVIPEQISTAGTEAS
3ddwB           LNCRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSLKVIFLENYRVSLAEKVIPAQISTAGTEAS
3cuvA           LNCLHVKEPNKFVVPRTVMIGGKLITAIGDVVNHDPVVGDRLRVIFENYRVSLAEKVIPAQISTAGTEAS
2bguA           KMVEFLF-----DTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALKNYNDNFI
1c8lA           LNCLIKKEPNKFVVPRTVMIGGKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIEQISTAGTEAS
3ddsA           LNCLIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSLKVIFLENYRVSLAEKVLSEQISTAGTEAS
3bjxB           -YLPLAWRRSAEALITRYAEQAADELRERSLLNIGPLPNLKERLYAAGFDDGEVRRVLYAFNYGNPKYLL
1bx3A           LNCRIKKEPNKFVVPRTVMIGGKDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEAS
2c4mB           MNARIKEDGLTDIPARTVIFGAKAAPGYVRAKAIIKLINSLKVVFVENYNVSPAEHILPAQISTAGKEAS
3d0rA           GAVEPIIAAAGEVD-ADFVLALGDLDISPLGTLPRN------VRAVGWTPLHTLLRTCTAVVH----HGG
2c1xA           AEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKRGYG---MVVPWAPQAEVLA--HEAVGAFVTHCG
2c9zA           --VVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRG--YGMVVPWAPQAEVLA--HEAVGAFVTHCG
3bjxD           -YLPLAWRRSAEALITRYAEQAADELRERSLLNIGPLPNLKERLYAAGFDDGEIEKVRRVLYAFNYGNPK
1bc9A           MGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFT
2c1zA           --VVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPW----APQAEVLAHEAVGAFVTHCG
3d0rB           GAVEPIIAAAGEVD-ADFVLALGDLDISPLGTLPRN------VRAVGWTPLHTLLRTCTAVVH----HGG
1ahpA           LYKEIRENPQADRVPRVFLFGAKAAPGYYLAKNIIFAINKLKVVFLPDYCVSAAEKLIPEQISTAGKEAS
2ecpA           LYKEIRENPQADRVPRVFLFGAKAAPGYYLAKNIIFAINKLKVVFLPDYCVSAAEKLIPEQISTAGKEAS
1dvgA           ----------------------------------------------------PYTPATQHYVKRLHEVGG


                         .         *         .         .         .         .         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
3c48B           GLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDHARTFSW
3c4qB           GLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLETRIRMGEDAVEH-ARTFSW
3c48A           GLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDHARTFSW
3beoA           GGVQEEAPSLGVPVLVLRDTTERPEGIEAGTLKLAGTDEETIFSLADELLSDKEAMSKASNPY-GDGRAS
3c4qA           GLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLETRIRMGEDAVEH-ARTFSW
2bisA           GLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFCKKRAMSFSW
3dzcA           GGIQEEAPSLGKPVLVMRETTERPEAVAAGTVKLVGTNQQQICDALSLLLTDP-QAYQAMSQ-AHNPYGD
2acvA           WNSILESMWFGVPILTWPIYAEQQLNAFRVAAEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNAVVDGGSS
3d1jA           GLTQLYGLKYGTLPLVRRTGGLADTVDSSLENLADGVASLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSW
2c4mA           GTSNMKFMMNGALTLGTMDGANVEIVNAYIFGARVEELPALRESYKPYELYETVPGLKRALDALDNGTLN
3e3lA           GTGNMFMLNGALTIGTMDGANVEMAENFFIFGMR--VEDVDRLDQRGYNAQEYYDRIPELRQQLSSGFFS
2atiA           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDAALDKKGYEAKEYYEALPKLVIDQIDNGFFS
2c4mC           GTSNMKFMMNGALTLGTMDGANVEIVGEENAYIFGARVEELPALRESYKPYETVPGLKRALDALDNGTLN
3e3nE           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQQLSSGFFS
3copA           GLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENLADGVAWSLLRAIRRAFSRPSLWRFVQRQAMAMDFSW
3e3oD           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQQLSSGFFS
1c3jA           TLRVWETMASDAVMLIDEEFDTKHRINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKKAEW
3cuyA           PVYLADSSMKLLQYDFFGLPAVCPVGPYKSRFGYTPGNADSVIAAITQALRVRYRQCLNWSDTTDRVLDP
3e3oA           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDDRLDQRGYNAQEYYDRIPRQIIEQLSSGFFS
2bgtA           TLRVWETMASDAVMLIDEEFDTKHRINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAK
1b4dA           GTGNMKFMLNGALTIGTMDGANVEMAEEAGEIFGMRVEDDRLDQRGYNAQEYYDRIPEQIIEQLSSGFFS
1e1yA           GTGNMKFMLNGALTIGTMDGANVEMAEENFFIFGMRVEDVDLDQRGYNAQEYYIPELRQIIEQLSSGFFS
3cv3A           PVYLADSSMKLLQYDFFGVCPNAVVGPYKSRFGYTPGNADSVIAAITQALRVRYRQCLNWSDTTDRVLDP
2bfwA           GLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRE--------
3e3oB           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDVDLDQRGYNAQEDRIPELRQIIEQLSSGFFS
3e3lB           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDDRLDQRGYNAQEYYDRIPRQIIEQLSSGFFS
3e3oC           GTGNMFMLNGALTIGTMDGANVEMAENFFIFGMRVVDRLDQRGYNAQEYYDRIPELRQIIEQ-LSSGFFS
1e4oA           GTGNMKLALNGALTVGTLDGANVEIAEKVGEEFIFGHTVQVKAILAKGYDPVKWRKKDKVLDELESGKYS
3e3lC           GTGNMFMLNGALTIGTMDGANVEMAENFFIFGMR-VEDVDRLDQRGYNAQEYYDRIPEQIIEQLSSGFFS
3cejA           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDAALDKKGYEAKEYALPELKLVIDQIDNGFFS
3cehA           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDVALDKKGYEAKEYYEALPKLVIDQIDNGFFS
3dd1B           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDAALDKKGYEAKEYYEALPKLVIDQIDNGFFS
3e3lD           GTGNMFMLNGALTIGTMDGANVEMAENFFIFGMR--VEDVDRLDQRGYNAQEYYDRIPELRQQLSSGFFS
3e3nC           GTGNMFMLNGALTIGTMDGANVEMAEEAGEEIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQQLSSGFFS
2acvB           WNSILESMWFGVPILTWPIYAEQQLNAFRWGVGLGLRVDEEIEKGLKDLMDKDSIKVQEMKEMSRNAVDG
3ddsB           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDVALDKKGYEAKEYYEALPKLVIDQIDNGFFS
1a8iA           GTGNMFMLNGALTIGTMDGANVEMAEFIFGMRVEDVDRLDQRGYNAQEYYDRIPEL-RQIIEQLSSGFFS
3ddwB           GTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRIDDVALDKKGYEAKEYALPELKLVIDQIDNGFFS
3cuvA           GTGNMFMLNGALTIGTMDGANVEMAEFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQI-IEQLSSGFFS
2bguA           TLRVWETMASDAVMLIDEEFDTKHRINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKKAEW
1c8lA           GTGNMKFMLNGALTIGTMDGANVEMANFFIFGMRVVDRLDQRGYNAQEYYDRIPELRQIIEQ-LSSGFFS
3ddsA           GTGNMKFMLNGALTIGTMDGANVEMANLFIFGMR-IDDVAALDKKGYEAKEYYEAELKLVIDQIDNGFFS
3bjxB           LITALSESQ--RPVGGAEVSSELRASIPKGHPKGDPLL--------------------------------
1bx3A           GTGNMKFMLNGALTIGTMDGANVEMAEENFFIFGMRVEDDRLDQRGYNAQEYYDRIPEQIIEQLSSGFFS
2c4mB           GTSNMKFMMNGALTLGTMDGANVEIVNAYIFGARVEELPALRESYKPYELYETVPGLKRALDALDNGTLN
3d0rA           GGTVMTAIDAGIPQLLAPDPRDQFQVSRRGIGLV-STSDKVDADLLRRLIGDESLRTAEVREEMVALPTP
2c1xA           WNSLWESVAGGVPLICRPFFGDQRLNLEIGVRIEGGVFTKSLMSCFDQILSNLRALRETADRAVGPKGSS
2c9zA           WNSLWESVAGGVPLICRPFFGDQRLNLEIGVRIEGGVFTKSGLMSCFDQIENLRALRETADRAVGPKGSS
3bjxD           YLLLITALSEQRPVGGAEVSSELRASIPKGHPKGDPLLPLVDATKASTEVQGLLKRVADLHY--------
1bc9A           DLNLVQALFLWSFRLPGEAQKIDRMMQCNNGVFQ-STDTCYVLSFAIIMLNTSVKDKPTVERFIAMNDGG
2c1zA           WNSLWESVAGGVPLICRPFFGDQRLNGRMGVRIEGGVFTKSLMSCFDQILSNLRALRETADRAVGPKGSS
3d0rB           GGTVMTAIDAGIPQLLAPDRDQFQHTARRGIGLVS-TSDKVDADLLRRLIGDESLRTREVREEMVALPTP
1ahpA           GTGNMKLALNGALTVGTLDGANVEIAEKVGEIFGHTVKQVKAILAKGYDPVKWRKKDKVLDAELESGKYS
2ecpA           GTGNMKLALNGALTVGTLDGANVEIAEKVGEIFGHTVKQVKAILAKGYDPVKWRKKDKVLDAELESGKYS
1dvgA           THPLLVAHAYTRYLGDLSGGQLKKIAQKALALPSSGEGLASFTFPSIDNPTKFKQLYRARNTLELTPEVK


                         .         .         .         .         *         .         .:420
query           EAILEKHEKLYHExxx
3c48B           AATAAQLSSLYND---
3c4qB           AATAAQLSSLYND---
3c48A           AATAAQLSSLYND---
3beoA           ERIVEAILKHFNK---
3c4qA           AATAAQLSSLYND---
2bisA           EKSAERYVKAYTG---
3dzcA           GKACQRIADILAK---
2acvA           LISVGKLIDDI-----
3d1jA           QVAAKSYRELYY----
2c4mA           DNNSGLFYDLKHS---
3e3lA           PKQPDLFKDIVNM---
2atiA           PKQPDLFKDIINM---
2c4mC           DNNSGLFYDLKHS---
3e3nE           PKQPDLFKDIVNM---
3copA           QVAAKSYRELYYR---
3e3oD           PKQPDLFKDIVNM---
1c3jA           QDAFKKAIDL------
3cuyA           RAYPE--TRLY-----
3e3oA           PKQPDLFKDIVNM---
2bgtA           KAEWQDAFKKAID---
1b4dA           PKQPDLFKDIVNM---
1e1yA           PKQPDLFKDIVNM---
3cv3A           RAYPE--TRLY-----
2bfwA           ----------------
3e3oB           PKQPDLFKDIVNM---
3e3lB           PKQPDLFKDIVNM---
3e3oC           PKQPDLFKDIVNM---
1e4oA           DGDKHAFDQMLHS---
3e3lC           PKQPDLFKDIVNM---
3cejA           PKQPDLFKDIINM---
3cehA           PKQPDLFKDIINM---
3dd1B           PKQPDLFKDIINM---
3e3lD           PKQPDLFKDIVNM---
3e3nC           PKQPDLFKDIVNM---
2acvB           GSSLISVGKLIDD---
3ddsB           PKQPDLFKDIINM---
1a8iA           PKQPDLFKDIVNM---
3ddwB           PKQPDLFKDIINM---
3cuvA           PKQPDLFKDIVNM---
2bguA           QDAFKKAIDL------
1c8lA           PKQPDLFKDIVNM---
3ddsA           PKQPDLFKDIINM---
3bjxB           ----------------
1bx3A           PKQPDLFKDIVNM---
2c4mB           DNNSGLFYDLKH----
3d0rA           AETVRRIVERI-----
2c1xA           TENFITLVDLV-----
2c9zA           TENFITLVDLV-----
3bjxD           ----------------
1bc9A           DLPEELLRNLYES---
2c1zA           TENFITLVDLVSK---
3d0rB           AETVRRIVER------
1ahpA           DGDKHAFDQMLHS---
2ecpA           DGDKHAFDQMLHS---
1dvgA           HRVTEEAKTAF-----