[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a1fA.bssp"
#ERROR : Can't open dsspfile "3ek5F.bssp"
#ERROR : Can't open dsspfile "3ek5A.bssp"
#ERROR : Can't open dsspfile "3ek5B.bssp"
#ERROR : Can't open dsspfile "2bndA.bssp"
#ERROR : Can't open dsspfile "2bndB.bssp"
#ERROR : Can't open dsspfile "2bneB.bssp"
#ERROR : Can't open dsspfile "3ek6A.bssp"
#ERROR : Can't open dsspfile "2bneA.bssp"
#ERROR : Can't open dsspfile "3ek6B.bssp"
#ERROR : Can't open dsspfile "2c10B.bssp"
#ERROR : Can't open dsspfile "2bnfA.bssp"
#ERROR : Can't open dsspfile "2bnfB.bssp"
#ERROR : Can't open dsspfile "2atqB.bssp"
#ERROR : Can't open dsspfile "2egxA.bssp"
#ERROR : Can't open dsspfile "2c10A.bssp"
#ERROR : Can't open dsspfile "2a1kB.bssp"
#ERROR : Can't open dsspfile "2brxB.bssp"
#ERROR : Can't open dsspfile "3c1nB.bssp"
#ERROR : Can't open dsspfile "2egxC.bssp"
#ERROR : Can't open dsspfile "3c1mA.bssp"
#ERROR : Can't open dsspfile "3c1mC.bssp"
#ERROR : Can't open dsspfile "2bmuB.bssp"
#ERROR : Can't open dsspfile "3c1nC.bssp"
#ERROR : Can't open dsspfile "2btyA.bssp"
#ERROR : Can't open dsspfile "2akoA.bssp"
#ERROR : Can't open dsspfile "3c1nD.bssp"
#ERROR : Can't open dsspfile "3c1mD.bssp"
#ERROR : Can't open dsspfile "3d41A.bssp"
#ERROR : Can't open dsspfile "2bufJ.bssp"
#ERROR : Can't open dsspfile "2bufC.bssp"
#ERROR : Can't open dsspfile "3c1nA.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "2bufK.bssp"
#ERROR : Can't open dsspfile "2ap9A.bssp"
#ERROR : Can't open dsspfile "2bufI.bssp"
#ERROR : Can't open dsspfile "2bufE.bssp"
#ERROR : Can't open dsspfile "2ap9E.bssp"
#ERROR : Can't open dsspfile "2bmuA.bssp"
#ERROR : Can't open dsspfile "2bufH.bssp"
#ERROR : Can't open dsspfile "2bufG.bssp"
#ERROR : Can't open dsspfile "1e19A.bssp"
#ERROR : Can't open dsspfile "2cdqA.bssp"
#ERROR : Can't open dsspfile "2bufA.bssp"
#ERROR : Can't open dsspfile "3d40A.bssp"
#ERROR : Can't open dsspfile "1b7bA.bssp"
#ERROR : Can't open dsspfile "2bufB.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "2bufD.bssp"
#ERROR : Can't open dsspfile "2bufL.bssp"
#ERROR : Can't open dsspfile "2ap9B.bssp"
#ERROR : Can't open dsspfile "2e9yB.bssp"
#ERROR : Can't open dsspfile "2e9yA.bssp"
#ERROR : Can't open dsspfile "2bufF.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3e59B.bssp"

## Summary of PDB Search
:249
    8e-49  45%  2a1fA  [x.x.x] URIDYLATE KINASE
    2e-39  45%  3ek5F  [x.x.x] URIDYLATE KINASE
    3e-39  44%  3ek5A  [x.x.x] URIDYLATE KINASE
    3e-38  44%  3ek5B  [x.x.x] URIDYLATE KINASE
    4e-38  43%  2bndA  [x.x.x] URIDYLATE KINASE
    1e-37  43%  2bndB  [x.x.x] URIDYLATE KINASE
    3e-37  45%  2bneB  [x.x.x] URIDYLATE KINASE
    8e-37  44%  3ek6A  [x.x.x] URIDYLATE KINASE
    1e-36  43%  2bneA  [x.x.x] URIDYLATE KINASE
    2e-36  44%  3ek6B  [x.x.x] URIDYLATE KINASE
    1e-32  10%  2c10B  [x.x.x] MEMBRANE COPPER AMINE OXIDASE
    2e-29  36%  2bnfA  [x.x.x] URIDYLATE KINASE
    2e-29  37%  2bnfB  [x.x.x] URIDYLATE KINASE
    2e-29  14%  2atqB  [x.x.x] GP32
    6e-29  19%  2egxA  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    2e-28  11%  2c10A  [x.x.x] MEMBRANE COPPER AMINE OXIDASE
    2e-28  14%  2a1kB  [x.x.x] GP32 SINGLE STRANDED DNA BINDING PROTEIN
    6e-28  22%  2brxB  [x.x.x] URIDYLATE KINASE
    4e-27  18%  3c1nB  [x.x.x] PROBABLE ASPARTOKINASE
    6e-26  17%  2egxC  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    2e-25  19%  3c1mA  [x.x.x] PROBABLE ASPARTOKINASE
    6e-25  19%  3c1mC  [x.x.x] PROBABLE ASPARTOKINASE
    6e-25  22%  2bmuB  [x.x.x] URIDYLATE KINASE
    1e-24  17%  3c1nC  [x.x.x] PROBABLE ASPARTOKINASE
    2e-24  16%  2btyA  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-24  19%  2akoA  [x.x.x] GLUTAMATE 5-KINASE
    4e-24  18%  3c1nD  [x.x.x] PROBABLE ASPARTOKINASE
    6e-24  19%  3c1mD  [x.x.x] PROBABLE ASPARTOKINASE
    1e-23  14%  3d41A  [x.x.x] FOMA PROTEIN
    5e-23  16%  2bufJ  [x.x.x] ACETYLGLUTAMATE KINASE
    8e-23  16%  2bufC  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-22  19%  3c1nA  [x.x.x] PROBABLE ASPARTOKINASE
    2e-22  22%  2brxA  [x.x.x] URIDYLATE KINASE
    3e-22  17%  2bufK  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-22  18%  2ap9A  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-22  17%  2bufI  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-21  16%  2bufE  [x.x.x] ACETYLGLUTAMATE KINASE
    4e-21  18%  2ap9E  [x.x.x] ACETYLGLUTAMATE KINASE
    4e-21  23%  2bmuA  [x.x.x] URIDYLATE KINASE
    4e-21  16%  2bufH  [x.x.x] ACETYLGLUTAMATE KINASE
    6e-21  15%  2bufG  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-20  18%  1e19A  [c.73.1] CARBAMATE KINASE-LIKE CARBAMOYLPHOSPHATE
    4e-20  18%  2cdqA  [x.x.x] ASPARTOKINASE
    5e-20  16%  2bufA  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-19  13%  3d40A  [x.x.x] FOMA PROTEIN
    4e-19  19%  1b7bA  [c.73.1] CARBAMATE KINASE
    2e-18  15%  2bufB  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-18  15%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    3e-18  15%  2bufD  [x.x.x] ACETYLGLUTAMATE KINASE
    5e-18  16%  2bufL  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-17  18%  2ap9B  [x.x.x] ACETYLGLUTAMATE KINASE
    5e-17  25%  2e9yB  [x.x.x] CARBAMATE KINASE
    6e-17  19%  2e9yA  [x.x.x] CARBAMATE KINASE
    2e-14  16%  2bufF  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-12  48%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-11  48%  2a1fE  [x.x.x] URIDYLATE KINASE
    4e-11  44%  2a1fF  [x.x.x] URIDYLATE KINASE
    7e-08  47%  2a1fC  [x.x.x] URIDYLATE KINASE
    6e-07   7%  3e59B  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
2a1fA           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRG-
3ek5F           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGA
3ek5A           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRG-
3ek5B           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRG-
2bndA           ----------------------SGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGA
2bndB           ----------------------SGEAL-QGTEFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGA
2bneB           ----------------------SGEAL-QGTEFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGG
3ek6A           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGA
2bneA           ----------------------SGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGA
3ek6B           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRG-
2c10B           ----------------------------------------------------------------------
2bnfA           ----------------------SGEALQGTEGFGIDASILDRAQEIKE-LVELGIQVGVVIGGGNLFRGA
2bnfB           ----------------------SGEAL-QGTEFGIDASILD-RAQEIKELVELGIQVGVVIGGGNLFRGA
2atqB           ----------------------------------------QAVIRFLPAKTDDALPFAILVNHGFKKNGK
2egxA           ----------------------GGAEGINYEAVAKDAASLWKEGVKLLLVHGGSAETNKVAEALGHPPRF
2c10A           ----------------------------------------------------------------------
2a1kB           ----------------------------------------QAVIRFLPAKTDDALPFAILVNHGFKKNGK
2brxB           ----------------------GGSVLV---PENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYI
3c1nB           ---------------------------------------------------------SRIEELEKVLIGV
2egxC           ----------------------GGAEGINYEAVAKDAASLWKEGVKLLLVHGGSAETNKVAEALGHPPRP
3c1mA           ---------------------------------------------------------SRIEELEKVLIGV
3c1mC           ---------------------------------------------------------SRIEELEKVLIGV
2bmuB           ----------------------GGSVLVPE---NPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYI
3c1nC           ---------------------------------------------------------SRIEELEKVLIGV
2btyA           ----------------------GGSAMKQENAKKA-------FIQDIILLKYTGIKPIIVHGGGPAISQM
2akoA           ----------------------GSHVISEENT--LSFERLKNLVAFLAKLE--KYEVILVTSAA----IS
3c1nD           ---------------------------------------------------------SRIEELEKVLIG-
3c1mD           ---------------------------------------------------------SRIEELEKVLIGV
3d41A           ----------------------GGSLFSKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFGHG
2bufJ           ----------------------GGNAMESEELKAGFAR-------DVVLMKAVGINPVVVHGGGPQIGDL
2bufC           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
3c1nA           ----------------------------------------------------------------KVLIGV
2brxA           ---------------------------------NPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYI
2bufK           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
2ap9A           ---------------------------------------------QITALRRLGIEGDFKGGFRVT----
2bufI           ----------------------GGNAM-------ESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDL
2bufE           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
2ap9E           ---------------------------------------------QITALRRLGIEGDFKGGFRVT----
2bmuA           ----------------------GGSVLVPE---NPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYI
2bufH           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
2bufG           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
1e19A           ----------------------GGNALQQRGQKGSYMDNVRKTARQIAEIIARGYEVVITHGNGPQVGSL
2cdqA           ----------------------------------LHIRTVKELNIDPSVILTYLEELEQLLKGIAMMKE-
2bufA           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
3d40A           ----------------------GGSLFSKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGALAGL
1b7bA           ----------------------GGNAISNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGQQAADS
2bufB           ----------------------------------ESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDL
3d2pA           ------------------------------------------LAADIGLLSQLGIRLVLIHGAYHFLDRL
2bufD           ----------------------------------ESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDL
2bufL           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
2ap9B           ---------------------------------------------QITALRRLGIEGDFKGGFRVT----
2e9yB           ----------------------------------------------------------------------
2e9yA           ----------------------GGNAIAGPGMVESQTAAVKRASSIIADVLADGWRSVITHGNGYLSE-A
2bufF           ------------------------------------------FARDVVLMKAVGINPVVVHGGGPQIGDL
2a1fD           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fF           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRG-
2a1fC           ----------------------------------------------------------------------
3e59B           ----------------------------------LSLSFLNHLCQRIQLFYAPGAKITVCSDGRLVRIGD


                         .         .         *         .         .         .         .:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
2a1fA           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
3ek5F           GLAAS-GMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAI--KINDVCEDFIRAIRHLEKGRIAI
3ek5A           AGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek5B           AGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
2bndA           GL-AKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVI
2bndB           GL-AKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVI
2bneB           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
3ek6A           GL-AASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
2bneA           GL-AKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
3ek6B           AGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
2c10B           ---------LTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIV
2bnfA           GLAKA--GNRVVGDHGLATVNGLARDALHRAYVNARLSAIPLNVCDS------YSWAEAISLLRNNRVVI
2bnfB           GLAKA--GNRVVGDHGLATVNGLARDALHRAYVNARLSAIPLNVCDSY------SWAEAISLLRNNRVVI
2atqB           WY--IETCSSTHGDYDSCPVCQYISKNDLYNTNKTEYSQLKRKTSYWANILVVKDPQAPDNERFGKKIWD
2egxA           VSRL---TDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLS--GLDGRLFVGRRKDYTGTLQAGYLPV
2c10A           ---------DLSREE---LTAVMRFLTQRLGPGLVRPSDNCVFSVELQLPPK-AAALAHLDRAREALAIV
2a1kB           WY--IETCSSTHGDYDSCPVCYISKNDLYNTNKTYSQLKRKTSYWANILVVKDDNEGKVFKYRFGKKIWD
2brxB           EVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQ------------LKKIPV
3c1nB           AYL--GELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALE--GGEAGIITDNNFGSARVLKEGIIPV
2egxC           GGQVSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDYTGTVEEVNKALLDLLLQAGYLPV
3c1mA           AYL--GELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGGSARVKRLEVKERLLPLLKEGIIPV
3c1mC           AY--LGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALE--GGEAGIITDNNFGSARVLKEGIIPV
2bmuB           EVAEKFNSSETFKDFIGIQITRANALLIAALREKAYPVVVED----------------FWEAWKAVQLKK
3c1nC           AYL--GELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLKEGIIPV
2btyA           MKDLGIEPVEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKGKVKKVNPEILHALIENDYIPV
2akoA           AGHTKLDIDRKNLINKQVLAAIGQPFLISVLLAKFNKLGGQILLTGKDFDSRKATKHAKNADINLGILPI
3c1nD           -VAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKS--IALEGGEAGIITDNNFGSARVLKEGIIPV
3c1mD           AYL--GELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALE--GGEAGIITDNNFGSARVLKEGIIPV
3d41A           AIRD-HDSTHAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQ--LAAMCTLRNGIPQLRSELDHGALPV
2bufJ           LKRLSIEMRVTDAATMDVVEMVLGNKDIVNLINRHGGSAIGLTGKGHVGEVTGVNVGLLNMLVKGDFIPV
2bufC           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLT--GKDAELIRAKKLTVTRQTEMTKPEI
3c1nA           AY--LGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALE--GGEAGIITDNNFGSARVLKEGIIPV
2brxA           EVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMG----------
2bufK           LKRLSIESHAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLT--GKDAELIRAKKLTVNMLVKGDFIPV
2ap9A           --------TPEVLDVARVLFGQVGR-ELVNLINAHGPYAVGITGEDAQLFTAVGDVDQVNTAVAAGRIPV
2bufI           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAEDIGHVGEVTGVNVGLLNDFIPV
2bufE           LKRLSIEMRVTDAATMDVVEMVLGNKDIVNLINRHGGSAIGLTGKDAEGEVTGVNVGLLNMLVKGDFIPV
2ap9E           --------TPEVLDVARVLFGQVGR-ELVNLINAHGPYAVGITGEVATDIGLVGDVDQVNTAVAAGRIPV
2bmuA           EVAEKFNSSETFKDFIGIQITRANALLIAALR-------EKAYPVVVE---------DFWEAWKAVQLKK
2bufH           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGK-DAELIRAKKLTVTRQTPEMTKPEI
2bufG           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLT-VTRQTPEMTKPEI
1e19A           LLHMDAGQPAQPMDVAGAMSQGWIGYMIKNELRKRGMEKKVVTIITTKPVGPFYDEETAKKLVERGVIVI
2cdqA           -------LTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDGDILEATYPAVAKRLYDDWMHDPAVPI
2bufA           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAEGEVTGVNVGLLNMLVKGDFIPV
3d40A           TEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEV------LRDVLDHGALPVLAGDALFD
1b7bA           EKNPAMPLDTCVAMTQGSIGYWLSGPFLTEAEAKEAMQAGAIFKEPSPKPIDIHEAETINTLIKNDIITI
2bufB           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQEMVKGDFIPV
3d2pA           AAAQGRTPHETSLGQAQQFAGTVRSRFEAALPSVPLVSGNFLTARPITDMEYAGVIRKTDTALDAGNIVW
2bufD           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAE-----LIRAKKLTVTRQTKPEI
2bufL           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAEDIGHVGEVTGVNVGVKGDFIPV
2ap9B           --------TPEVLDVARVLFGQVGR-ELVNLINAHGPYAVGITGE--DAQLFTAVRRAALDLVAAGRIPV
2e9yB           ----------------------------------------------------------------------
2e9yA           FEALPPERPRQPLYIATAMTQAWIGLLLKHSL--------------------------------------
2bufF           LKRLSIETDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQPEVKGDFIPV
2a1fD           ---------------MGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fE           ---------------MGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fF           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fC           --------NRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
3e59B           AHISAYQDALRLMIEEIGATHIGVEQLRQLLIGGYAEPLESIRETLLASEEGLLLYRAITRFLYEDGLTP


                         +         .         .         .         .         *         .:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
2a1fA           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDC-------AKLYKNLSYAEVIDKELKVMDLS
3ek5F           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek5A           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek5B           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
2bndA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2bndB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2bneB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
3ek6A           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
2bneA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPP---TATMYEQLTYSEVLEKELKVMDLA
3ek6B           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
2c10B           FFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHC
2bnfA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTAT-YEQLTYSEVLEKEL-KVDLA
2bnfB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTAT-YEQLTYSEVLEKEL-KVDLA
2atqB           KINAMIAVDTEMGETVDVTCPWEGANFVLKVKQVSGFSNYDESKFSAIPNIDDESFQKELFEQMVDLS--
2egxA           LTPPALSYNTDGDQIAALLATLYGAEALVYLSNVPGLLASLVREIPVE-RIEDPEYLALAQGRMKRKVMG
2c10A           FFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHC
2a1kB           KINAMIAVDTEMGETVDVTCPWEGANFVLKVKQVSGFSNYDESKFSAIPNIDDESFQKELFEQMDLSEMT
2brxB           MGGT--HPGHTTDAVAALLAEFLKADLLVVITNVDGVYAKKIKKMKPEELLEIVGK--------SVIDPL
3c1nB           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAAYFGAKVLHPR
2egxC           LTPPALSINTDGDQIAALLATLYGAEALVYLSNVPGLLARYPDEASLVREIPVERIEDLAQGRMKRKVMG
3c1mA           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIELAYFGAKVLHPR
3c1mC           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYMELAYFGAKVLHPR
2bmuB           IPVGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKVGKGIEKAGSSSVIDPL
3c1nC           VTGFIGTGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIELAYFGAKVLHPR
2btyA           IAPVGIGENINADTAAAEIAKSLMAEKLILLTDVDGVLKDGKLSTLTPDEAEELIRDGTVTGGMIPKVEC
2akoA           INEIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKRLEKITHIKEHGTGGIVTKLK
3c1nD           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSAMELAYFGAKVLHPR
3c1mD           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIELAYFGAKVLHPR
3d41A           LAGDALLWAFSSDRVPEVLLPMVEGRLRVVTTDVDGIVTDD-TILPEVDARSPEQAYAADATGAMHTKLD
2bufJ           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2bufC           IDIGHVGEVTGVNVGLLNMLVKGDAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
3c1nA           VTGFIGTTRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIELAYFGAKVLHPR
2brxA           ----GTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVKSVIDPL
2bufK           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2ap9A           VSTLAPDANINADTAAAAVAEALGAEKLL-LTDIDGLYTRWPDRDSLVSETGTLAQLLPTLELGVPKVEA
2bufI           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2bufE           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2ap9E           VSTLAPDANINADTAAAAVAEALGAEKLL-LTDIDGLYTRWPDRDSLVSETGTLAQLLPTLELGVPKVEA
2bmuA           IPVGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKVGKGIEKAGSSSVIDPL
2bufH           IDIGHVGEVTGVNVGLLNMLVKGDAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2bufG           IDIGHVGEVTGVNVGLLNMLVKGDAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
1e19A           ASGGGGVPVIDKDLAGEKLAEEVNADIFMILTDVNGAALYYGTE--KEQWLREVKVEEFKAGSMGPKVLA
2cdqA           VTGFLGKGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRATPVPYLTFDEAAYFGAQVLHPQ
2bufA           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELDGTIYGGMLPKIRC
3d40A           EHGKLWA--FSSDRVPEVLLPMVEGRLRVVTLTVDGLPEVDARSPEQA-----YAALWGSSEGAMHTKLD
1b7bA           SCGGGGIPVIDKDFASEKLAELVDADALVILTGVDYVC--INYGKPDEKQLTNVTVAELEEYKQAGHFAP
2bufB           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTVNELIADGTIYGGMLPKIRC
3d2pA           MPPLGGKTFNLDMVQAAASAVSLQAEKLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRLISS
2bufD           IDIGHVGEVTGVNVGLLNMLVKGDAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIATIYGGMLPKIRC
2bufL           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELDGTIYGGMLPKIRC
2ap9B           VSTLAPDANINADTAAAAVAEALGAEKLL-LTDIDGLYTRWPD---RDSLVSEIDTGTLAQLLPTLELGV
2e9yB           ---------VDKDLASSLLATQLNADLLVILTDVPGVAVNYGRE--GERWLRRAAASEFPPGSMGPKVEA
2e9yA           ---------VDKDLASSLLATQLNADLLVILTDVPGVAVNYGRE--GERWLRRAAASEFPPGSMGPKVEA
2bufF           IAPIGVGSNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSQVNELIADGTIYGGMLPKIRC
2a1fD           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNL-------SYAEVIDKELKVMDLS
2a1fE           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLY-------KNLSYAEVIDKELKVMDLS
2a1fF           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNL-------SYAEVIDKELKVMDLS
2a1fC           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAK-------LYKNLSYAEVIDKELKVMDLS
3e59B           DYQGSKTALQRSWAWGALLADQFPRAIRLSIHPQPADSLKFGIH--------------------------


                         .         .         .         +         .         .         .:280
query           AFTQCRDFGIPIYVFDLTQPNALVDAVLDSKYGTWVTLD
2a1fA           AFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGTTI---
3ek5F           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ--
3ek5A           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ--
3ek5B           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ--
2bndA           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bndB           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bneB           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
3ek6A           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ--
2bneA           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
3ek6B           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ--
2c10B           CFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYN-----
2bnfA           AFTLARDHKLPIRVFNNKPGALR--RVVGEKEGTLIT--
2bnfB           AFTLARDHKLPIRVFNNKPGAL--RRVVGEKEGTLIT--
2atqB           ----------EMTSKDKFKSFEELNTKFNQVLGT-----
2egxA           AVEAVKGGVKRVVFADGRVENPIRRAL--SGEGTVV---
2c10A           CFYKHRGRNLVTMTTAPRGLQSG----------------
2a1kB           SKDKFKSFEELNTKF------------------------
2brxB           AAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTI---
3c1nB           TIEPAMEKGIPILVKNTFEPESEGTLITNDSDSIVK---
2egxC           AVEAVKGGVKRVVFADGRVENPIRRAL--SGEGTVV---
3c1mA           TIEPAMEKGIPILVKNTFEPESEGTLI------------
3c1mC           TIEPAMEKGIPILVKNTFEPESEGTL-------------
2bmuB           AAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTI---
3c1nC           TIEPAMEKGIPILVKNTFEPESEGTLITNDMSIVKA---
2btyA           AVSAVRGGVGAVHIINGGLEHAILLEIFRKGIGTMIK--
2akoA           AAKFLLEHNKKFLASGFDLSVAKTFLLEDKQIGG-----
3c1nD           TIEPAMEKGIPILVKNTFEPESEGTLITNDSIVKAISTI
3c1mD           TIEPAMEKGIPILVKNTFEPESEGTL-------------
3d41A           ALVTCARRGAECFIMRGDPGSDL-EFLTAPFSSWPA---
2bufJ           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2bufC           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
3c1nA           TIEPAMEKGIPILVKNTFEPESEGTLITNDMDS------
2brxA           AAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTI---
2bufK           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2ap9A           CLRAVIGGVPSAHIIDGRVTHCVLVELFDAGTGTKVV--
2bufI           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2bufE           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2ap9E           CLRAVIGGVPSAHIIDGRVTHCVLVELFDAGTGTKVV--
2bmuA           AAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTI---
2bufH           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2bufG           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
1e19A           AIRFIEWGGERAIIAHLEKA----VEALEGKTGTQV---
2cdqA           SMRPAREGEIPVRVKNSYNPKAP----------------
2bufA           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
3d40A           ALVTCARRGAECFIMR-GDPGSDLEFLTAPFSSWPAH--
1b7bA           GSMLPKISQPNK-QAIITSLENLGSMSGDEIVGTVV---
2bufB           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
3d2pA           AVAALEGGVHRVQ--------------------------
2bufD           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2bufL           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2ap9B           CLRAVIGGVPSAHIIDGRVTHCVLVELFDAGTGTKVV--
2e9yB           AISFVERTGKPAVIGSLEEA----RQVLSLQAGTVVM--
2e9yA           AISFVERTGKPAVIGSLEEA----RQVLSLQAGTVVM--
2bufF           ALEAVQGGVTSAHIIDGRVPNAVLLEIFDSGVGTLIS--
2a1fD           AFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGT-----
2a1fE           AFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGT-----
2a1fF           AFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGT-----
2a1fC           AFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGT-----
3e59B           ---------------------------------------