[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD31463.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d54A.bssp"
#ERROR : Can't open dsspfile "2btuA.bssp"
#ERROR : Can't open dsspfile "2btuB.bssp"
#ERROR : Can't open dsspfile "3c9uB.bssp"
#ERROR : Can't open dsspfile "3c9tB.bssp"
#ERROR : Can't open dsspfile "1cliA.bssp"
#ERROR : Can't open dsspfile "3c9rA.bssp"
#ERROR : Can't open dsspfile "3c9tA.bssp"
#ERROR : Can't open dsspfile "1cliB.bssp"
#ERROR : Can't open dsspfile "3c9uA.bssp"
#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "3bpkA.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "4ccxA.bssp"
#ERROR : Can't open dsspfile "6ccpA.bssp"
#ERROR : Can't open dsspfile "3ebeB.bssp"
#ERROR : Can't open dsspfile "7ccpA.bssp"
#ERROR : Can't open dsspfile "2btuB.bssp"
#ERROR : Can't open dsspfile "3c9uB.bssp"
#ERROR : Can't open dsspfile "3c9tB.bssp"
#ERROR : Can't open dsspfile "3c9rA.bssp"
#ERROR : Can't open dsspfile "3c9tA.bssp"
#ERROR : Can't open dsspfile "3c9uA.bssp"

## Summary of PDB Search
:1290
    6e-78  23%  3d54A  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    2e-42  13%  2btuA  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
    6e-33  16%  2btuB  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
    7e-31  13%  3c9uB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    2e-30  14%  3c9tB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    2e-29  12%  1cliA  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    3e-28  12%  3c9rA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    7e-28  12%  3c9tA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    4e-23  12%  1cliB  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    1e-21  12%  3c9uA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    5e-21  22%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    3e-19  13%  2abwB  [x.x.x] PDX2 PROTEIN
    2e-18  18%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    6e-18  13%  2abwA  [x.x.x] PDX2 PROTEIN
    5e-16  10%  3bpkA  [x.x.x] NITRILOTRIACETATE MONOOXYGENASE COMPONENT B
    7e-16  13%  3bweD  [x.x.x] PROTEIN DJ-1
    1e-15  15%  3bweE  [x.x.x] PROTEIN DJ-1
    1e-11  10%  4ccxA  [x.x.x] CYTOCHROME C PEROXIDASE
    2e-07  10%  6ccpA  [x.x.x] CYTOCHROME C PEROXIDASE
    6e-05  19%  3ebeB  [x.x.x] PROTEIN MCM10 HOMOLOG
    0.001  12%  7ccpA  [x.x.x] CYTOCHROME C PEROXIDASE
    2e-04  16%  2btuB  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE(query 679->951)
    2e-13  13%  3c9uB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 221->596)
    5e-13  12%  3c9tB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 233->599)
    7e-07  12%  3c9rA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 233->591)
    4e-11  13%  3c9tA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 233->599)
    3e-20  12%  3c9uA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 651->909)
:1290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
3d54A           --------------------------------------------KLRYLNILKEKLGREPTFVELQAFSV
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ---------------------------TPEDTTPDNGRLPDMDKDAGYVRTFFQRLNMNDREVVALMGAH
6ccpA           --------------------------------TPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAH
3ebeB           ----------------------------------------------------------------------
7ccpA           -------------------------------------RLPDADKDAGYVRTFFQRLNMNDREVVALMGAH
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYS
3d54A           MWSEHCGYSHTKKYIRRLP-------------------------KTGNAGVVNLDDYYSV----------
2btuA           --------------------EAGYEAVSRMKKHVQTTMRKGGFGGMFDLSKFALE-EPVLVSGTDG----
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------ELGEFGLIDLIK---KTLESKVIGDDTAPVE---------------YC
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ALGTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMPTDYSLIQDPKYLSYA
6ccpA           ALGTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSGYMMLPTDYSLIQDPKYLSYA
3ebeB           ----------------------------------------------------------------------
7ccpA           ALGKHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNETDYSLIQDPKYLKEYANDQDK----
2btuB           ----------------------------------------------------------------------
3c9uB           ----------FQGSFTMRLK--ELGEFGLIDLIKKT---LESKVIGDDTAPVE---------------YC
3c9tB           ----------------------ELGEFGLIDLIKKT---LESKVIGDDTAPVE---------------YC
3c9rA           ----------------------ELGEFGLIDLIKKT---LESKVIGDDTAPVE---------------YC
3c9tA           ----------------------ELGEFGLIDLIKKT---LESKVIGDDTAPVE---------------YC
3c9uA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FNQEEVDILMKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPGFEQAWET
3d54A           --------AFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMG--ARPTAIFDSLHMSRI-----------
2btuA           ---------VGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQG--AEPLFFLDYIACGKAEPSKIENIVK-
2btuB           -----SGTDGGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQG--AEPLFFLDYIACGKAEPSKIENIVK-
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ---------VGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQG--AEPLFFLDYYATGKLDVDTASAVIS-
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ---------VGTKLRLAMDLKRHDTIGIDLVAMCVNDLVV--QGAEPLFFLDYYATGKLDVDTASAVIS-
3c9uA           SKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIAN--GGLPKWALISLNLP----EDLEVSY--
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           NDQDKFF-KDFSKAFEKLLENGITFPKD-APSPFIFKT--------------------------------
6ccpA           NDQDKFFK-DFSKAFEKLLENGITFPKD-APSPFIFKT--------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           FFKDFSKAFEKL------LENGITFPKD-APSPFIFKT--------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           SKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIAN--GGLPKWALISLNLP----EDLEVSY--
3c9tB           SKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIAN--GGLPKWALISLNLP----EDLEVSY--
3c9rA           SKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANG--GLPKWALISLNLP----EDLEVSY--
3c9tA           SKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANG--GLPKWALISLNLP----EDLEVSY--
3c9uA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKYGKPNHIVTPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTSAGKEMFGYHKPIMIAGGMANI
3d54A           ------------IDGIIE---GIADYGNSIGVPTVGGELRISSL-----------YAHNPLVNVLAAGVV
2btuA           ---------------------GISEGCRQAGCALIGGE---------TAEMPGMYSTEEYDLAGFTVGIV
2btuB           ---------------------GISEGCRQAGCALIGGETAEMPG-----------MYTEEYDLAGFTVGI
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ---------------------GIAEGCLQSGCSLVGGETAEMPG----------MYHGEDYDVAGFVGVV
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ---------------------GIAEGCLQSGCSLVGGETAEMPG----------MYHGEDYDVAGCVGVV
3c9uA           -----VERFYI----------GVKRACEFYKCEVVGG---------------NISKSEKIGISVFLVGET
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ------------VERFYI---GVKRACEFYKCEVVGGN--ISK--------------SEKIGISVFLVGE
3c9tB           ------------VERFYI---GVKRACEFYKCEVVGGN--ISKSEKIGISV---FL----VGETE--RFV
3c9rA           ----------------VERFYGVKRACEFYKCEVVGG---------NISKSEKIGISVFLVGETERF--V
3c9tA           ----------------VERFYGVKRACEFYKCEVVGG---------NISKSEKIGISVFLVGETERF--V
3c9uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KRMHVEKGDIKVGAKLICLGGPAMRIXXXXXXXXXXXXXDTNSELDFASVQRDNAEMERRCQEVIDRCWQ
3d54A           RNDMLVDSKSRPGQVIVIFGGATGRD------------------GTKLSIQVGDPFAEKMLIEA---FLE
2btuA           DKKKIVTGE-KIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILE
2btuB           KKKIVTGEKIEAGHVLIGLASSGI------------------HSNGYSLVRKVGEELLKPTKIYVKPILE
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           EKSEIIDGSVSDGDVLIALGSSGP---HSNGYSLVRKILEVSGCDPQTTELDGKPHLLAPTRIYVKSVLE
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           EKSEIIDGSVSDGDVLIALGSSGP---HSNGYSLVRKILEVSGCDPQTTELDGKPHLLAPTRIYVKSVLE
3c9uA           ERF-VGRDGARLGDSVFVSGTLGD-----SRAGLELLLMEKEEYEPFELALIQRHLRPTA---RIDYVKH
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           TERFVGRDGARLGDSVFVSG----TLGDSRAGLELLLMEKEEYEPFELALIQRHLRPTARIDYVK-----
3c9tB           GRDGARLGDSVFVSGTLGDSRAGLEL----------LLMEKEEYEPFELALIQRHLRPTA------RIDY
3c9rA           GRDGARLGDSVFVSGTLGDSRAGLELLLMEKEEY---------EPFELALIQRHLRPTARIDYVKHI---
3c9tA           GRDGARLGDSVFVSGTLGDSRAGLELLLM-----------------------EKEEYEPFELALIQRHLR
3c9uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MGENNPITFIHDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESL
3d54A           MVEEGLVEGAQDLGAGGVLSATSELVAKGNLGAIVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKA
2btuA           LLKNHEVYGMAHITGGGFIENIPRMLP-EGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFVVAVKEEDA
2btuB           LLKNHEVYGMAHITGGGFIENIPRMLPE-GIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFVVAVKEEDA
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           LIEKVDVHAIAHLTGGGFWENIPRVLPD-NTQAVIDESSWQWPEVFNWLQTAGNVEHHEGMIIALPAPEV
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           LIEKVDVHAIAHLTGGGFWENIPR-VLPDNTQAVIDESSWQWPEVFNWLQTAGNVEHHEGMIIALPAPEV
3c9uA           IQ---KYANASMDISDGLVADANHLAQRSGVKIEILSEKLPLSKYGKNPIEYALFGGEDYLLFTHPKERW
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           -------------------------------------------FSGLRIRKPRSSEMERKGRKLIRLAQL
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           --HIQKYANASMDISDGLVADANHLAQRSGVKIEILSEKLPLSNEGKNPIEYALFGGEDYLLFTHPKERW
3c9tB           VKHIQKYANASMDISDGLVADANHLAQRSGVKIEILSEKLPLSKYGKNPIEYALFGGEDYLLFTHPKERW
3c9rA           ----QKYANASMDISDGLVADANHLAQRSGVKIEILSEKLPLSNELKMYCEKYGKNPIEYALFTHPKERW
3c9tA           PTHIQKYANASMDISDGLVADANHLAQRSGVKIEILSEKLPLSKYGKNPIEYALFGGEDYLLFTHPKERW
3c9uA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ELFEQLCNRERCPFAVVGEAISEKHITLNDEYFDNKPVDLPMGLLFGNTPQMHIDVKTVKVEQQAFDTSA
3d54A           SRILEIARKHLLFGDVVAEVIEEPVYRV--MYRNDLVMEVPVQLLANAPEEDIVE---------------
2btuA           KDIVRLLEEQGETARIIGRTVQGAGVTFN-----------------------------------------
2btuB           KDIVRLLEEQGETARIIGRTVQGAGV--------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           DKALALLNANGENAWKIGIIKASDSEQR------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           DKALALLNANGENAWKIGIIKASDSEQR------------------------------------------
3c9uA           N--------PFLDMTEIGRVEEGEGVFVDGKKVEPKGWK-------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           QNKIATEKLEEEDWVTFGVIVKKITTFSI--WRLNDLKDLDSLFLFGDVHKWKTDQGTV-----------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           NPF--------LDMTEIGRVEEGEGVFVDGKKVEPK----------------------------------
3c9tB           NPF--------LDMTEIGRVEEGEGVFVDGKKVEPKGWK-------------------------------
3c9rA           N--------PFLDMTEIGRVEEGEGVFVDGK---------------------------------------
3c9tA           N--------PFLDMTEIGRVEEGEGVFVDGKKVEPKGWK-------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           IKLDEAIERVLKVPAVASKSFLITIGDRSITGMVARDQMVGPWQVPVADCAVTTATVDSQAGEAMAMGER
3d54A           YTPGKIPEFKRVEFEEVNAREVFEQYDHMVGT--------DTVVPPGFGAAVM--RIKRDGGYSLVTHSR
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           -------------------SFTMRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEG
3c9tB           -------------------SFTMRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEG
1cliA           ----------------------------------------------------------------------
3c9rA           -------------------SFTMRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEG
3c9tA           ----------------------MRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEG
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ------------------------------------------------PVLVSGTDGGTKLMLAFMADK-
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           --------------------FTMRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEG


                         .         .         .         .         +         .         .:770
query           TPVAAINAAASGRLAIAETVTNLLAADIEKLSDIRLSANWMVAANQGDENQKLYETVRAVGMEFAPALGI
3d54A           ADLALQDTYWGTLIAVLESVRKTLSVGAEPL-AITNCVNYGDPDVDPVGLSAMMTALK----NACEFSGV
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           VHFLSYIPEAVGWKAISVNVSDVIANGGLPK------WALISLNLPEDLEVSYVERFYIGVKRACEFYKC
3c9tB           VHFLSYIPEAVGWKAISVNVSDVIANGGLPK------WALISLNLPEDLEVSYVERFYIGVKRACEFYKC
1cliA           ----------------------------------------------------------------------
3c9rA           VHFLSYIPEAVGWKAISVNVSDVIANGGLPK------WALISLNLPEDLEVSYVERFYIGVKRACEFYKC
3c9tA           VHFLSYIPEAVGWKAISVNVSDVIANGGLPK------WALISLNLPEDLEVSYVERFYIGVKRACEFYKC
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           -------HDTIGIDAVAMCVNDIVVQPLFFLDYIACGKA---------EPSKIENIVKGIS-EGCRQAGC
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           VHFLSYIPEAVGWKAISVNVSDVIANGGL---PKWALISLNLPE--DLEVSYVERFYIGVK-RACEFYKC


                         .         .         *         .         .         .         .:840
query           AIPVGKDSMSMKTKWSDNGQAKSVTSPLSLVISGFSPVTNARKTLTPVLVDDNDTTLLHIDLSNGAGRLG
3d54A           PVASGNASLYNTYQGK--------PIPPTLVVGML-----GKVNPQKVAKPKPSKVFAVGWNDFELEREK
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           EV-VGGNISKSE----------------KIGISVFL-VGETERFVGRDGARLGDSVFVSGTL--GDSRAG
3c9tB           EV-VGGNISKSE----------------KIGISVFL-VGETERFVGRDGARLGDSVFVSGTL--GDSRAG
1cliA           ----------------------------------------------------------------------
3c9rA           EV-VGGNISKSEKIG--------------ISVFL---VGETERFVGRDGARLGD--SVFVSGTLGDSRAG
3c9tA           EV-VGGNISKSE----------------KIGISVF-LVGETERFVGRDGARLGD--SVFVSGTLGDSRAG
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           AL-IGGETAEMPGMYTEE-----------YDLAGFTVIVDKKKIVTGEKIEAGHVLIGLASS--GIHSNG
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           EV-VGGNISKSE----------------KIGISVFL-VGETERFVGRDGARLGDSVFVSGTL--GDSRAG


                         +         .         .         .         .         *         .:910
query           ASCLAQAYNQVGNVAPDIEASKVKVLFENITKLKAENKILAYHDVSDGGVFATLAEMSFAGRKGLDVKLQ
3d54A           E----------------------------LWRAIRKLSEEGAFILSSSQLLTRTHVETFRYGLKIEVKLP
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           LELLLMEKEEYEPFELAL-IQRHLRPTARIDYVKHIQKYANASMDISDGLVADANHLAQRSGVKIEILSE
3c9tB           LELLLMEKEEYEPFELAL-IQRHLRPTARIDYVKHIQKYANASMDISDGLVADANHLAQRSGVKIEILSE
1cliA           ----------------------------------------------------------------------
3c9rA           LELLLMEKEEYEPFELAL-IQRHLRPTARIDYVKHIQKYANASMDISDGLVADANHLAQRSGVKIEILSE
3c9tA           LELLLMEKEEYEPFELALIQRHLRP-TARIDYVKHIQKYANASMDISDGLVADANHLAQRSGVKIEILSK
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           YSLVRKVLLEDGPLGEELLKPT-KIYVKPILELLKNHEVYGMAHITGGGFIENIPRML---PEGIGAEIE
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           LELLLMEKEEYEPFELALIQRHLRPTARIDYVKHIQ-KYANASMDISDGLVADANHLAQRSGVKIEILS-


                         .         .         .         +         .         .         .:980
query           TQDVLAKLFAEEVGVVIQVRNSDVSLVEEMFKDTQIHLCAIAKLNSSDELNIxxxxxxxxxNTRVNLQRW
3d54A           PAHQMVLVFSERTPVVD-----------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           KLPLYALFGGEDYQLLFTHPKERWNPFLD-----------------------------------------
3c9tB           KLPLELKMYCEKYGK-------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           KLPLYALFGGEDYQLLFTHPKERWNPFLDMT---------------------------------------
3c9tA           NPIEYALFGGEDYQLLFTHPKERWNPFLDMTE--------IGRVEEGEGVFV------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3bpkA           -------------------------------------------------------------QRKAGERKD
3bweD           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           LGSWMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARII-----------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           WAETSYQIQSIRDNSECAKQEFDSILNTNDKGIHVEATFDLEEDITAKFVNVEKPKVTILREQGVNGQVE
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           -----------------------------------------------------KPRACVVVYPGSNCDRD
2abwB           -----------------------------------------------------EITIGVLSLQGDFEPIN
2aexA           ----------------------------------------------------------------------
2abwA           -----------------------------------------------------EITIGVLSLQGDFEPIN
3bpkA           TSRNAIEKGEFVVHISDESYVAAINEANESEIELAKLTPIESEVISVPG-----VKEANIRECVLERAIP
3bweD           -------------------------------------------------------RALVILAKGAEEETV
3bweE           -----------------------------------------------------SKRALVILAKGAEEETV
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           MAAAFTTAGFEAHDVHMSDLHAGRVTLADFKVLVACGGFSYGDVLGAGGGWAKNILFTEKLRDEFSRFFG
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           AYHALEINGFEPSYVGLDD------KLDDYELIILPGGFSYGDYLRPGAVAAR-----EKIAFEIAKAAE
2abwB           HFIKLQIPSLNIIQVRNVHD------LGLCDGLVIPGGESTTVRRCC-------AYENDTLYNALVHFIH
2aexA           ----------------------------------------------------------------------
2abwA           HFIKLQIPSLNIIQVRNVH------DLGLCDGLVIPGGESTTVRRCC-------AYENDTLYNALVHFIH
3bpkA           LGGTEDSPACRVVRFHVAEYEKGRIHAEGLKPISRLAGHNYAKL--------------------------
3bweD           IPVDVRRAGIKVTVAGLAGQCSRDVVICPDASLEDAKKEGPYDVLPGGNLGAQNLSESAAVKEILKEQEN
3bweE           IPVDVRRAGIKVTVAGLAGQCSRDVVICPDASLEDAKKEGPYDVLPGGNLGAQNLSESAAVKEILKEQEN
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           RDDTLALGVCNGCQMLAQLKSLIKGAENWPIFIKNKSEQFEARVSMVEIQESDSIWFADMACTKAPIAVA
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           RG-KLIMGINGFQILIEM-------GLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFE---------
2abwB           VLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICR-------------NFYGSQNDSFICS
2aexA           ----------------------------------------------------------------------
2abwA           VLKKPIWGTCAGCILLSK-------NVENIKLYSNFGNKFSFGGLDITICRNFNDSFICSLNIISDSSAF
3bpkA           ----------------------------------------------------------------------
3bweD           RKGLI-AAICAGPTALLA-HEIGFGSKVTTHPLAKDKNGGHYTYSENRVEKDGLILTSRGP--GTSFEFA
3bweE           R-KGLIAAICAGPTALLAHE-IGFGSKVTTHPLAKDKNGGHYTYSENRVEKDGLILTSRGPGTSFEFALA
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           HGEGRPLFENDNQQQAMLASAQVALKYIDGQGQATEMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVY
3d54A           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3d54D           ----------KGEKIRIPIAHGFGRYVKIDDVNVVLRYVKDVNGSDERIAGVLNESGNVFGLMPHPERAV
2abwB           LNIISDSSAFKKDLTAACIRAPYIREILSDEVKVLATFSHESYGPNIIAAVE---QNNCLGTVFHPEL--
2aexA           -------------------------------------VEFNLLYDRGTKFGLFTPGSRIESLMSLPLTAR
2abwA           KKDLTAACIRAPYIREIL-------------SDEVKVLATFSHESYGPNIIAAVEQNNCLGTVFHPEL--
3bpkA           ----------------------------------------------------------------------
3bweD           LAIVEALN--------------------------------------------------------------
3bweE           IVE-------------------------------------------------------------------
4ccxA           ----------------------------------------------------------------------
6ccpA           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
7ccpA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           RAITNSHIPAEYDEYSVWMRMFRNARKWVx
3d54A           ------------------------------
2btuA           ------------------------------
2btuB           ------------------------------
3c9uB           ------------------------------
3c9tB           ------------------------------
1cliA           ------------------------------
3c9rA           ------------------------------
3c9tA           ------------------------------
1cliB           ------------------------------
3c9uA           ------------------------------
3d54D           EELIGGED---------GKKVFQSILNYL-
2abwB           -----LPHTAFQQY---FYEKVKNYKYSL-
2aexA           --WEYMHSPSENSKEAEILEVLRHPRDWV-
2abwA           -----LPHTAFQQY---FYEKVKNYKYSL-
3bpkA           ------------------------------
3bweD           ------------------------------
3bweE           ------------------------------
4ccxA           ------------------------------
6ccpA           ------------------------------
3ebeB           ------------------------------
7ccpA           ------------------------------
2btuB           ------------------------------
3c9uB           ------------------------------
3c9tB           ------------------------------
3c9rA           ------------------------------
3c9tA           ------------------------------
3c9uA           ------------------------------