[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30153.1

[Show Plain Result]


## Summary of Sequence Search
    1::118
    4::63      3e-05  30%   71 aa  PF04355 SmpA_OmlA "SmpA / OmlA family"
    1::118

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKDKKLFEIKPNMTKSEVTYILGSPDIIDTFNPN
PF04355         ------------------------------------LTQENVAKIQVGMTKDQVRRLLGKPSSVDTFNNN


                         .         .         *         .         .         .         .:140
query           QYVYINTYKRNMQDTQFSESKLILTFNNxxxxxxxxxxxxxxxxxxxx
PF04355         TWYYVFYQRRGKGAVE--QKVLTVTFDD--------------------