[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30160.1

[Show Plain Result]


## Summary of Sequence Search
    1::403
    1::194     4e-59  55%  194 aa  PF00926 DHBP_synthase "3,4-dihydroxy-2-butanone 4-phosphate
    3::162     3e-40  52%  169 aa  PF00925 GTP_cyclohydro2 "GTP cyclohydrolase II"
    1::403

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKATEENIAFMLEHTSGIICLAMDSKKARE
PF00926         --------IEEAIEALRNGKMVIVVDDEDRENEGDLIIAAEAVTPEQIAFMIRHGSGLICLPLTEERADR
PF00925         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LNLTPMVAADQNNSTFTTPFTVTIEAKEGVTTGVSAKDRAHTIQVASKADAKTEELARPGHIFPLIANDK
PF00926         LGLPPMVT--NNTDPHGTAFTVSVDAADGTTTGISAADRALTIRALADPDAKPEDFRRPGHVFPLRARDG
PF00925         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKAAELEAFAKKHDLPLLTIAELYQYRxxxxxx
PF00926         GVLERRGHTEAAVDLARLAGLKPAGVICEILNDDGTMARLPDLLAFAKKHGLKVITIEDLIEYR------
PF00925         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxKMASSTIPFKKIGELEMSVYKDNFSGDEVVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQDQLHK
PF00926         ----------------------------------------------------------------------
PF00925         --RVAEARLP-TRFGEFRLVGYRDLIDGKEHLALVKGIDPDEPLVRVHSECLTGDVFGSLRCDCGEQLDE


                         .         *         .         .         .         .         +:350
query           GIEMISEEGGFFIYLDQEGRGIGLTNKLKAYNLQMNENMDTLEANLALGLPADARKYDLAIQVLKYNNVN
PF00926         ----------------------------------------------------------------------
PF00925         ALRLIAEEGGVLVYLRQEGRGIGLLNKLKAYNLQ-DLGLDTVEANLLLGFPADARDYGLGAQILRDLGVK


                         .         .         .         .         *         .         .:420
query           RCRLISNNPEKLAALRNVDIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00926         -----------------------------------------------------
PF00925         KIRLLTNNPDKIVALEGFGLE--------------------------------