[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30267.1

[Show Plain Result]


## Summary of Sequence Search
    1::209
    2::187     2e-39  42%  188 aa  PF02223 Thymidylate_kin "Thymidylate kinase"
   27::141     4e-05  27%  142 aa  PF01712 dNK "Deoxynucleoside kinase"
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
PF02223         --------EGIDGSGKTTQIKLLAERLEAQGIKVVLTREPGGTPIGELIRELLLGK--NEDLDPRTEALL
PF01712         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
PF02223         FAADRAQHLEEVIKPALARGKIVICDRYIDSTLAYQGAGRGLDLDLVAQLNDFALGGLKPDLTLYLDVPP
PF01712         ---------------------SIYSDRLIFAENLFASGTLSTEYDIYDELFDNLVEELPPDLIIYLRASP


                         +         .         .         .         .         *         .:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILxxxxxxxx
PF02223         EVALARARARGELDRIEEEDLEFHERVREGYLELAAEPERIVVIDASQSIEEVHE--------------
PF01712         ETCLERIKKRGRPEE-KSIPLDYLKELHEAYEDWLEKYDESIDIDELDFVKNPDDLLLLIL--------