[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30290.1

[Show Plain Result]


## Summary of Sequence Search
    1::1417
    3::326     2e-68  50%  326 aa  PF04997 RNA_pol_Rpb1_1 "RNA polymerase Rpb1, domain 1"
    1::471     2e-65  37%  471 aa  PF04998 RNA_pol_Rpb1_5 "RNA polymerase Rpb1, domain 5"
    1::166     1e-35  51%  166 aa  PF00623 RNA_pol_Rpb1_2 "RNA polymerase Rpb1, domain 2"
    1::145     2e-18  41%  145 aa  PF04983 RNA_pol_Rpb1_3 "RNA polymerase Rpb1, domain 3"
    7::78      1e-10  44%  107 aa  PF05000 RNA_pol_Rpb1_4 "RNA polymerase Rpb1, domain 4"
   41::181     7e-04  30%  218 aa  PF10469 AKAP7_NLS "Protein kinase A anchor protein nuclear
    1::1417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
PF04997         ---------------DSIRFGLASPEEIRKWSVGEVTKPETINYRG-KPEKGGLFDERIGG---------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GKYKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
PF04997         GKYKRVCETCGVEVTEC---------RGHMGHIELAAPVYHPWFFKGLPSRIGCLLCGKLKLLESVIYFA
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQXXXXXXXXXX
PF04997         SYVVLAPGLDPLKRLQLLYDDEINEDADKKGQPFVRKMGAEALKELLKKIEEEEELKEEKRELTPSEVLN
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXX
PF04997         ILKKISKRLKVLLGFSNSGARPEWMILTVLPVPPPDLRPSVQLDGGRFAESDLNDLYRRIINRNNRLKRL
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNxxGKRVDYSGR
PF04997         LEEGAPEIIVRNEKRLLQEAVDALIDNGRRGRPVAGANNRPLKSLSDRLKGKEGRFRQN-----------
PF04998         ----------------------------------------------------------------------
PF00623         -------------------------------------------------------------GKRVDFSGR
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         SVIVPDPNLSLDEVGVPREIAKELTYPEVVTPLNIEGAKIDLRKKKREIRPELWIGWIVLRHLIDGDPVL
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSxxNILS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         LNRQPTLHRLSIMAFRVKLLPGRTIRLHPLVCKPYNADFDGDEMNVHVPQSLEARAEARLLMLS------
PF04983         ------------------------------------------------------------------NILS
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         PATGEPIIGPSQDMVLGLYYLTRR--------DTFLSKEEVMNALYQGIVLPHPAIPLWTGKQTFSILFN
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         NINPKGKGKVIIRNGELLS--------GIIDKKTVGKSLGGLIHILFEEYGPEATARFLDRLKRLGFRYL
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLSGVSVGVDDMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNIINIWSKTSDEVGASMMDAIS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         TRAGFSIGIDDI----------------------------------------------------------
PF05000         -----------------------------------------------NKVIDIWGMTLEEVFEAMVNNIL
PF10469         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPxxxxxxxxxxxxxxxGLSVLQYF
PF04997         ----------------------------------------------------------------------
PF04998         --------------------------------------------------------------GLTVTEYF
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         NKARDEAGKKKSLPFDNNIYMMADSGAKGSAINISQLAGMRGQQAVP-----------------------
PF10469         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
PF04997         ----------------------------------------------------------------------
PF04998         ISCYGARKGLVDTAVKTADSGYLTRRLVDVAQDVIVRYDDCGTNRGISIVQFIYGEDGLDPLKDRLLGRV
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
PF04997         ----------------------------------------------------------------------
PF04998         LDKDIKDPFTIVRNQAIDLILEDLAKRLIRAGIQSIKIRSPLTCESTSGVCQLCYGRSLAHGALVELGEA
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
PF04997         ----------------------------------------------------------------------
PF04998         VGIIAAQSIGEPGTQLTLRTFHTGGVFTGNVTLGVPRLKEIINAS-KNIKTIRTVYGGNAAVKRNALAVI
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
PF04997         ----------------------------------------------------------------------
PF04998         IDIE---KENRNLP----------------------SKHIEEQLPNLIEKQLAQ-------SKNKLQIYI
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
PF04997         ----------------------------------------------------------------------
PF04998         GQLLRYGKEISP-GIGLNQSGGILILQSNKRYAKPFLLASGGICDLVQGDFVKNQSPLLNLKYKSLKTED
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
PF04997         ----------------------------------------------------------------------
PF04998         IVQGIPKIEQL---------------------------------------------LIARENFLDVLGGN
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         -------------------------------------KEFQE-SVLEQDPGLDESIIQPPKLHLVLLNDE


                         *         .         .         .         .         +         .:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
PF04997         ----------------------------------------------------------------------
PF04998         NLLKGKFLVYGTLYPHKIAVRKSFEKIQHYIVNEIQKVYRSQGVNISDKHIEIIVRQMTSKVRIEEAGDT
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         EVAKAEVLQECKESIREILRFRGLETMNDDVLLEVDHSGRLQEIAIRDAFVEA--------GLLVKDSDS


                         .         .         .         *         .         .         .:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAxxxxxxxxxxxxxxxxxxxx
PF04997         ----------------------------------------------------------------------
PF04998         GLLEGELVDLDWIERINLRHLALLGDPATYEPILLGITKASLNTRSFIAA--------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         VKLHATLMNLSR----RSKLRKKGKKKIDAEI--------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------
PF10469         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxx
PF04997         -----------------
PF04998         -----------------
PF00623         -----------------
PF04983         -----------------
PF05000         -----------------
PF10469         -----------------