[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30317.1

[Show Plain Result]


## Summary of Sequence Search
    1::484
   46::325     7e-07  24%  327 aa  PF02386 TrkH "Cation transport protein"
    1::484

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02386         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02386         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVEPFDA
PF02386         ---------------------------------------------------------------GMPLFDA


                         .         .         .         +         .         .         .:280
query           ICYTFSTVSTGGFAPSDASMTDKPLGMLIVCAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFL
PF02386         IFHAISAFNNAGFSLTDDSLNSDPLILLVII-LLIILGGLGFPVLLDLLRLKELSLFTKDVERRTFLLLF


                         .         *         .         .         .         .         +:350
query           FFTSFIVCITIITHTNDLSNIFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMFXXXXXXXXXX
PF02386         LGTVLLLLLELLNGLLGGLPLGAKRLAAFFQSSS-TRTAGFSTVDLSALSPASLLLLLILMFIGGSPGST


                         .         .         .         .         *         .         .:420
query           XXXXLKMIRAILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFXXXXXXXXXXX
PF02386         AGGIKTTRFAVLLKSLL----KRLVHPGAVSVVRFGGRRIPEQLVRKAWAIFLLYFLILIVETLLLSLTG


                         .         .         +         .         .         .         .:490
query           XDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPxxxxx
PF02386         LDFFTALFEVVSAFGTVGLSLGIVTPNLSFLGDLSKLVLIFLMFIGRLEILTVLLLLAP-----