[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30340.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
    1::167     6e-17  37%  169 aa  PF00106 adh_short "short chain dehydrogenase"
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
PF00106         -----RVALVTGAS-SGIGRAIARALAAEGAKVVVTARNAEALEELAAERVIAVQLDVTDEASVE-ALVE


                         .         .         *         .         .         .         .:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
PF00106         EVVEEFGRLDILVNNAGIAGDGPLEDLTEEDFDRVFDVNLLGPFLLTQAALPLMLARGGGRIVNISSVAG


                         +         .         .         .         .         *         .:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         LLGSPGQAAYAASKAALNGLTRSLAAE-------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         ----------------------------------------------------------------