[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30379.1

[Show Plain Result]


## Summary of Sequence Search
    1::167
    6::155     9e-07  24%  158 aa  PF03938 OmpH "Outer membrane protein (OmpH-like)"
    1::167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
PF03938         ----------LLLAGSAAAAQPKIAVVDMDKVLQQHPLTKAAQQQLQQQFKQLQQELQKLAAELQQQQQK


                         .         .         *         .         .         .         .:140
query           LQDNSATMTKSELDKKXXXXXXXXXNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
PF03938         LQQEMAQLSAAQRQQMQQQLQQQQQELQQKQQALQQQLQQEQQEERQKILDKIQKAIKKVAKERGYDLVL


                         +         .         .         .         .         *         .:210
query           TTQALAYVNNVDDISSQVVExxxxxxx
PF03938         DKNAVLYADPAVDITDEVLK-------