[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30394.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
    1::92      5e-18  50%   93 aa  PF00636 Ribonuclease_3 "RNase3 domain"
    2::66      2e-05  44%   66 aa  PF00035 dsrm "Double-stranded RNA binding motif"
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
PF00636         ------------------------------------ERLEFLGDAVLKLLISTYLFNTYPDLNEGLLTKL
PF00035         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSxxxxxxxxxxxxxxxx
PF00636         RSALVSNQTLARLARRLGLEDFLRAGSSDENGKIADKSLADCVEALIGAIYLDS----------------
PF00035         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
PF00636         ----------------------------------------------------------------------
PF00035         --------------KSRLQELCQKRGLPPPYYLVEE-EGPPHNKLFTVVEVGKEFG---EGEGKSKKEAE


                         .         .         .         +         .         .         .:280
query           QKTAEKMIEMLxxxxxxxxx
PF00636         --------------------
PF00035         QAAAEKALEKL---------