[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30441.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
    7::277     7e-40  40%  279 aa  PF00579 tRNA-synt_1b "tRNA synthetases class I (W and Y)"
   15::94      7e-05  39%  410 aa  PF01432 Peptidase_M3 "Peptidase family M3"
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
PF00579         -----VYTGIDPTGDLHLG-YLGPLRKLVRL-QDAGHDVIILIADLHALIGDPSRKLRTN-TREVANAQL
PF01432         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
PF00579         ACGLDPEKTTIFNQSDWPEHLELAWFLRCVTKHGTLNRMLQFK---DVKKRLESGD---GISLGEFSYPL
PF01432         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
PF00579         LQAADILLLKADLVPGGSDQKQNIELGRDLARRFNYKFPK-----PEALT---TPLLPGLDGTKMSKSDG
PF01432         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
PF00579         NAIFLDDDPESIKKKIKKAKTDPDREVRKGRPELSNLIEILEAFGDDPEAEELLAEYVTGLLHGGELKKA
PF01432         -------------------------------------YRAYYTRASETDNAAILEELLK--LRAELAKLL


                         .         *         .         .         .         .         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
PF00579         LAEALNE-----------------------------------------------
PF01432         GYESYAEYLADKMAK------TPEAVYDFLDDLAKKARPLAEKELAELKAELGL