[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30480.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
    1::45      3e-07  42%   47 aa  PF01022 HTH_5 "Bacterial regulatory protein, arsR family"
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIxxxxxxxxxxx
PF01022         --------------DPTRLRILRLLAEGELCVGELAEALGLSQSTVSQHLKVLREAGLV-----------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01022         ---------------------------------------------------