[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30541.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
   23::181     8e-14  31%  206 aa  PF02931 Neur_chan_LBD "Neurotransmitter-gated ion-channel ligand
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
PF02931         -------------------------------PVNVKVGLYLSSIIDVDEKNQDYTTNVWLRQSWNDERLA


                         .         .         *         .         .         .         .:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
PF02931         WNPSEYGGITSLR---LPSDKI---WLPDIFLYNDVTTPNTLVR---IYPDGTVLYSPRATLTSSCPMDL


                         +         .         .         .         .         *         .:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLxxxxxxxxxxxxxxxxx
PF02931         RYFPFDEQNCTLKFGSWTYTGSDVDLEWEEGDPVVVVDGIDLSQFILNGEWDI-----------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02931         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02931         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
PF02931         -