[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30570.1

[Show Plain Result]


## Summary of Sequence Search
    1::640
    3::95      2e-16  43%   95 aa  PF02806 Alpha-amylase_C "Alpha amylase, C-terminal all-beta domain"
    8::162     4e-13  33%  296 aa  PF00128 Alpha-amylase "Alpha amylase, catalytic domain"
    2::81      9e-10  42%   82 aa  PF02922 CBM_48 "Carbohydrate-binding module 48 (Isoamylase
    1::640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
PF02806         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF02922         ---------------------------------LGAHY---DGDGGVNFAVWAPNAKRVELVLDFNGWDG


                         .         .         *         .         .         .         .:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYxxxxxxxxxxxxxxxxxxxxxxx
PF02806         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF02922         EE----HPMTEGGVWEVFVPGGPHGTLYKYRVDGPGGPNKLL-LDPY-----------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYIKEMGYTHVEFMPLHEHPLDAS
PF02806         ----------------------------------------------------------------------
PF00128         -----------------------------------------------YLKDLGVTAIWLLPIFESPQNY-
PF02922         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
PF02806         ----------------------------------------------------------------------
PF00128         WGYDPLDYFAVDPRYGTLEDFKELVDAAHKRGIRVILDVVYNHTSEDHPWFLSSRGSPYRDYYIWRGSPP
PF02922         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNIxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02806         ----------------------------------------------------------------------
PF00128         NNWGQPDLNTENPEVREEIIDVLRYWLDE-GVDGFRFDAAKHL---------------------------
PF02922         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02806         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02806         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADNSQQSILSFIRSSKDN
PF02806         ----------------------------------------------------ADDNENNVIAFERGDKGG
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
PF02806         GEVLLVVFNFTPVSREDYRVGLPEAGTYREVLNSDAEKYGGSGRGKVTEV--------GSDGRLSITLPP
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           MATLVLKLIK
PF02806         LSALVLKKAK
PF00128         ----------
PF02922         ----------