[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30613.1

[Show Plain Result]


## Summary of Sequence Search
    1::528
   38::341     4e-53  41%  342 aa  PF01645 Glu_synthase "Conserved region in glutamate synthase"
    1::528

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
PF01645         -------------IVKRFNISAMSFGALSPEAHEALAIAANRLGGKSNTGEGGEDPERLGTGKAIKQVAS


                         .         .         .         +         .         .         .:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
PF01645         GRFG-------------VTPEYLVNADAIEIKIAQGAKPGEGGQLPGHKVTEEIAKLRGSPPGVDLISPP


                         .         *         .         .         .         .         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVXXXXXXXXXXPL
PF01645         PHHDIYSIEDLAQLIYDLKEANPGAPVGVKLVAEHGVGTIAVAKA------GADFITIDGHDGGTGAAPL


                         .         .         .         .         *         .         .:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
PF01645         SSIKHAGLPWELGLAEAHQTLVENGLRDRVRLIADGGLRTGRDVAKAAALGADEVGFGTAAMIALGCIMA


                         .         .         +         .         .         .         .:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLxxxxxxxxxxxxxxxxxx
PF01645         RKCHLNTCPVGVATQDPELRRRLDFEGKPERVVNYFRFLAEELREILAALGV------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         --------------------------------------