[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30665.1

[Show Plain Result]


## Summary of Sequence Search
    1::354
    2::195     9e-34  43%  198 aa  PF01223 Endonuclease_NS "DNA/RNA non-specific endonuclease"
    1::354

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01223         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01223         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
PF01223         ----DGYAVCYDRRRRIPLWVAEVLTPDSLAGSRGRSDVFREDPRVPASFQALNSDYTGSGYDRGHLAAA


                         .         .         .         +         .         .         .:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
PF01223         AADKASQSAQDATFLLTNIAPQNQGFNRGNWLYLENLVRKLAKENGDVYVVTGPLFVYQVAVETIGNGRV


                         .         *         .         .         .         .         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTxxxxxxxxxxxxxxxxx
PF01223         AVPTHFFKVVLDESDNGAAAFVLPNENIEETPTQ----PVEDIERLTGLDFFS-----------------


                         .         .         .         .         *         .         .:420
query           xxxx
PF01223         ----