[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30667.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
   16::112     2e-12  43%  117 aa  PF06903 VirK "VirK protein"
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxAFSKELNNYSDILNAVKDGKNITIFVDFSNCKPEIKVSGQFSPKSIMIHNDS
PF06903         ------------------AFPDPLNNYSAILRALMAGKDVTVIIDLSRCTPEAKTRGGVRIDAYRITSDT


                         .         .         *         .         .         .         .:140
query           IIFSDTHFTRNNPQYLNEPILEYVVYKINGNNVNITIDILDxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06903         IAFSDTHFTVDND---GKPIQQFMRYRINDGSAEFTTYVLD----------------------------