[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30680.1

[Show Plain Result]


## Summary of Sequence Search
    1::90
    1::90      4e-18  59%   90 aa  PF00216 Bac_DNA_binding "Bacterial DNA-binding protein"
    1::90

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSELVSAIAKEADVTKEVASNTLDATIAAVTKALKNGDSVTLVGFGTFQVKERSPREGRNPKTGETIK
PF00216         MTKSELIEAIAEKTGLSKKDAEAVLDALLEAITEALKKGEKVKLPGFGTFSVRERAARTGRNPKTGEEIK


                         .         .         *         .         .         .         .:140
query           IPASKVPSFKASKGLKDAVK
PF00216         IPARKVVKFKPGKKLKDAVE