[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30738.1

[Show Plain Result]


## Summary of Sequence Search
    1::287
    2::223     1e-30  40%  238 aa  PF00483 NTP_transferase "Nucleotidyl transferase"
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
PF00483         -----AVILAGGLGTRLRPLTRERPKKLLPVGGKPLIQYTLERLAAAGIEEIIVVTGYHKESIEEHLGDG


                         .         .         *         .         .         .         .:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
PF00483         YEL----------------------GVEITYVLQPEPLGTAHAVLLAADFIGDEPFVVVLPGDHLIDDD-


                         +         .         .         .         .         *         .:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
PF00483         ----FAELLEAHRETGADGLVTVGIVPVEDPTGYGVIERDEDGRVTRFVEKPDAETA-SNLANTGIYVFN


                         .         .         .         +         .         .         .:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         PGIFDLLELLEPLARGEPELTDAIPALLEEGKVVVAYLFRGS----------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
PF00483         -------