[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30798.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
    1::178     5e-19  36%  181 aa  PF00480 ROK "ROK family"
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
PF00480         -------------GIDIGGTKIKAALVDGEILARERIPTPSDDPEALLAALAELIAELLAEL--GRVLGI


                         .         .         *         .         .         .         .:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXX
PF00480         GIGVPGPVDPETGGVVSAPN-PGWRNVPLKEELEERLGLPVFVENDANAAALAEAWFGAGRGADDVVYVT


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         LGTGVGGGIVINGRLLRGANGNAGEIGHMP-VDGCLETYASG----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         ----------------------------------------------------------