[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30829.1

[Show Plain Result]


## Summary of Sequence Search
    1::111
    2::90      5e-21  47%   92 aa  PF01250 Ribosomal_S6 "Ribosomal protein S6"
    1::111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
PF01250         --HYEIMFIVRPDLSEEVKALVERYAKLITDNGGVIRKVEDWGRRRLAYPIKKLREGHYVLMNFDAPPEA


                         .         .         *         .         .         .         .:140
query           LEKLQESLRYNDAILRRLVIxxxxxxxxxxxxxxxxxxxxx
PF01250         IDELERTLRLNDRVLRHLVV---------------------