[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30912.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    1::167     3e-11  31%  169 aa  PF00106 adh_short "short chain dehydrogenase"
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
PF00106         ---RVALVTGASSGIGRAIARALAAEGAKVVVLARNALEELAAELVQLDVTDEASVEALVEEVVEEFGRL


                         .         .         *         .         .         .         .:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
PF00106         DILVNNAGIAGDGPLEDLTEEDFDRVFDVNLLGPFLLTQAALPLMLARGGGRIVNISSVALLGSPGQAAY


                         +         .         .         .         .         *         .:210
query           SAAKSALVGCTKTWALExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         AASKAALNGLTRSLAAE-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         -------------------------