[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30916.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
    2::102     7e-12  40%  105 aa  PF01906 DUF74 "Domain of unknown function (DUF74)"
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
PF01906         -IVTTTPTIPGYEIVEYLGIVTGEVVRGANIFRDFFAGLRDIVGGRSGSYEQALEEAREEAMERLKEEAE


                         .         .         *         .         .         .         .:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVxxx
PF01906         ELGANAVVGVRFDYENI-GQGSMLEVTAYGTAV---