[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD30919.1

[Show Plain Result]


## Summary of Sequence Search
    1::206
    1::86      8e-17  43%   86 aa  PF01227 GTP_cyclohydroI "GTP cyclohydrolase I"
    1::206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01227         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFEGTAEVSFIPKNNNIIGLCRINS
PF01227         ---------------------------------------------PFFGKAHIAYIP-GGRVVGLSKLAR


                         +         .         .         .         .         *         .:210
query           ICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGxxxx
PF01227         YVDSFARRLQFQERLTNQIADALQELLQPRGVAVVIEAEHMCMTMRGVIKIGSSTTTSAVGG----