[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31006.1

[Show Plain Result]


## Summary of Sequence Search
    1::509
   11::323     1e-16  24%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
   21::244     1e-06  24%  526 aa  PF06609 TRI12 "Fungal trichothecene efflux pump (TRI12)"
   41::145     3e-06  24%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
  263::366     7e-05  27%  402 aa  PF05977 DUF894 "Bacterial protein of unknown function (DUF894)"
  209::322     7e-04  25%  397 aa  PF03209 PUCC "PUCC protein"
    1::509

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDLTIVAVAIPQIMGAIGANVETIADVTTVYIVTAAIFI
PF07690         -------------------------------LDRSILSPALPALAEDLGLSPSQVGLLLSAFLLGYALGS
PF06609         -------------------------------------ASALPNILQDIGQS-ENWSLFSTLWTLGQAVSI
PF00083         ---------------------------------------------------------VVSILFLGALIGA
PF05977         ---------------------------------------------------------------VGALLGA
PF03209         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEY
PF07690         PPAGPLADRFGRRRVLLLGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIADWFPPEER
PF06609         LVVGRLSDRFGRRPFVIAGHILGLVGAIVGCTANTFNTLIAGMALLGVG-AGPAELSPLFIGELMSNKTK
PF00083         LFFGPLADRFGRKKALLLSLLLMAVGTLLIAFAPNPALLIVGRFLQGLGVGGESGVAPVYISEIAPPKKR
PF05977         LLLARLRRRLGRGRLLLLAALGFGLALLVLGLSPSLWLALLALALLGAAWAVANVSRNTLLQLATPDEMR
PF03209         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIKKIKIDYISFGF
PF07690         GRALGIFSAGGGLGAALGPLLGGLLAESLGWRWAFLILAILGLLALLLALLLLPEPPPEAKRLSPAEKLL
PF06609         FLGLLVVSIPTIVATFAGPYLAQRLSIQGNWRWIFYIYIIWSAIALVLIVVFYHPTQLKKAKLDWIGIFL
PF00083         GFLVSLYQLFITLGILLAALVG------------------------------------------------
PF05977         GRVFSLYSLVFMGGMPLGALLAGALAE-------------------------------------------
PF03209         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MAIGVGCLELFIDNGNTNGWFSSIKMIILLAISLVSIGFFIWRGLIYSSXXXXXXXXXXXXXLACFLCFM
PF07690         ERAPSPLLPLKLLLKNPVLW------LLLLALFLFGFGFY------------------------------
PF06609         VTAGLSLFLLGVSGGKPNYPWNSAKIIGPLTSGLGSLVAF------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF03209         --------------------------------------------------------------------FI


                         .         *         .         .         .         .         +:350
query           FVLLFSAAMAYLPTMLQQVYGYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSC
PF07690         ------GLLTFLPLYLQEVLGFSALQAGLLLALGGLVGAIGSLL-GGRLSDRLGPRRRLLLGLLLLLLGA
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF03209         FVFLGTLAFFMQDLILEEVFGMTVGETTKLTAFWGGGTLLGMLLAGFLLVRRLGPKRTAALGCLLGALAF


                         .         .         .         .         *         .         .:420
query           LMQANFSPTANEFDIILTTAIQGLGMMMFFVPFMSVLVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         LGLLLLGLTSSPVWLLVALALLGFGLGLAFPALLALL---------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF03209         LLLILAAPLGSPWLLRAGVFLFGLGNGLFAVAALTLMM--------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF03209         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxx
PF07690         -------------------
PF06609         -------------------
PF00083         -------------------
PF05977         -------------------
PF03209         -------------------