[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31053.1

[Show Plain Result]


## Summary of Sequence Search
    1::455
    2::57      6e-10  56%  160 aa  PF07724 AAA_2 "AAA domain (Cdc48 subfamily)"
    1::55      2e-07  47%  123 aa  PF00004 AAA "ATPase family associated with various cellular
    4::62      3e-07  56%   90 aa  PF10431 ClpB_D2-small "C-terminal, D2-small domain, of ClpB protein
    2::36      5e-04  40%  135 aa  PF07728 AAA_5 "AAA domain (dynein-related subfamily)"
    7::69      6e-04  45%  200 aa  PF01078 Mg_chelatase "Magnesium chelatase, subunit ChlI"
    1::455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
PF07724         --------------------------------------------------PKNFLFLGPTGVGKTELAKT
PF00004         -----------------------------------------------------VLLYGPPGTGKTTLARA
PF10431         ----------------------------------------------------------------------
PF07728         -----------------------------------------------------VLLVGPPGTGKTTLARA
PF01078         -------------------GQEEAKRALEIAAAGG----------------HNLLLIGPPGTGKSMLARR


                         .         .         *         .         .         .         .:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07724         LAKLSEKPLIRIDASEYTE----GEDVEHSVSRLI-----------------------------------
PF00004         LAKELGAPFIEISASELVS-KYVGES-EKRLRKLFEEAKK------------------------------
PF10431         ----------------------------------------------------------------------
PF07728         LAAALGRPLVRINLSKDT----------------------------------------------------
PF01078         LPGLL-PPLTEEEALEVASVAGLGKD--------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07724         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF10431         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEQNGIVFLDEIDKVCRKSSNS
PF07724         -------------------------------------------------EEGGIVLLDEIDK--------
PF00004         ----------------------------------------------------------------------
PF10431         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIxxxxxxxxxE
PF07724         ----AHPGVQNALLQILEGGRLTDKQGTVDTKNILFIMTGAFGGLKPSDFIPEFLGRLPI----------
PF00004         ----------------------------------------------------------------------
PF10431         ---------------------------------------------------------------------E
PF07728         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLExxxx
PF07724         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF10431         DLVRILTE---ALVKQYKRLLETEGVELEFTDEAIEAIAEKAYD-----PNTGARPLRRIIERLLE----
PF07728         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07724         -----------------------------------
PF00004         -----------------------------------
PF10431         -----------------------------------
PF07728         -----------------------------------
PF01078         -----------------------------------