[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31100.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    2::157     8e-11  32%  211 aa  PF01571 GCV_T "Aminomethyltransferase folate-binding domain"
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
PF01571         --FDVSHMGVIRVSGPDAAAFLQGLLTNDVSKLKPGR-ARYTAFLNEQGGILDDLIVYRLGEDEYLLVVN


                         .         .         *         .         .         .         .:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
PF01571         AGNAEKLLAWLKKYALRSKVEIEDVSDELALLAVQGPKAREVLQKLDALPFFTFREVTVGGVVSRTGYTG


                         +         .         .         .         .         *         .:210
query           AANFEKFLPAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01571         EDGFEIYVPAE-----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01571         --------------------------------------