[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31135.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    1::46      2e-07  48%   70 aa  PF04542 Sigma70_r2 "Sigma-70 region 2 "
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVLSHLRFVTK
PF04542         -----------------------------------------------------------LVERYLPLVYR


                         .         .         *         .         .         .         .:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04542         IARRLLGDGADAEDLVQEGFLGLWRALDKFDPGRG-----------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04542         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04542         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
PF04542         ------------