[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31158.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    3::168     5e-19  33%  171 aa  PF01612 3_5_exonuc "3'-5' exonuclease"
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
PF01612         --VDTEEELEELLEKLKKAKVVAFDTETTSLDPAELVGCLIQLATGEACYLPDPLADAVLAALKPLLEDP


                         .         .         *         .         .         .         .:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSXXXXXXXXXXXXXXXXSQFSDWRNRP
PF01612         SILKVGHNAKFDLHVLANDFGIELRGVFDTMLAAYLLDSGRRGGLDALAERYLGVTLDKEEQASDWKARP


                         +         .         .         .         .         *         .:210
query           LTQNQLNYAIKDVEYLIQLKEYLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01612         LTEEQIEYAAEDADVLLRLYEKLK----------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01612         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01612         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
PF01612         --------------