[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31166.1

[Show Plain Result]


## Summary of Sequence Search
    1::240
    4::210     7e-04  26%  229 aa  PF01048 PNP_UDP_1 "Phosphorylase superfamily"
    1::240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYXXXXXXXXXXXXXX
PF01048         --------------------IICGLPLEAAALAELPLEDIPYGPPGDGNTYTTGTIGGHNVVVASTGIGK


                         .         .         *         .         .         .         .:140
query           XXXXIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
PF01048         VSAAIAATRLLKSFGVRLIIRVGICGGLNPDIRLGDVV-VSTDVIQYDGGRPLTGPNEGGVRSDAKADPE


                         +         .         .         .         .         *         .:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMXXXXXXXXXXXXGKKASAVVTISDS
PF01048         LRAAAEEAAKELGPRVHYGTDGFY-KSTRARDRLARKLGALAVEMEAAGLAAVARENGVPCLVIRGISDY


                         .         .         .         +         .         .         .:280
query           FITGESTTAQQxxxxxxxxxxxxxxxxxxx
PF01048         ADSGKDDEAEE-------------------