[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31211.1

[Show Plain Result]


## Summary of Sequence Search
    1::412
   36::137     5e-04  29%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
    1::412

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLMIGIISAAYFFGMTAGSYFSQFTIIRV
PF00083         ------------------------------------------LLTGLVVSILFLGALIGALFFGPLADRF


                         .         .         *         .         .         .         .:140
query           GYIRAFVLFASLMAISTLIVGANKSVAVWILFRFLCGYSLAALFIIIESWCILSSDKKNRGLIFSIYLFV
PF00083         GRKKALLLSLLLMAVGTLLIAFAPNPALLIVGRFLQGLGVGGESGVAPVYISEIAPPKKRGFLVSLYLFI


                         +         .         .         .         .         *         .:210
query           YYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00083         TLG-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00083         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00083         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00083         --------------------------------------------------------------