[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31283.1

[Show Plain Result]


## Summary of Sequence Search
    1::365
    1::162     2e-24  48%  162 aa  PF00953 Glycos_transf_4 "Glycosyl transferase family 4"
    1::365

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00953         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
PF00953         ----------------------------VWLLLLSTLLMGLIGFLDDYL--------GLSARAKLLGQLL


                         +         .         .         .         .         *         .:210
query           FSIVLAIVLFYLLSKNGQMSLSIPFSKSLYIPMGXXXXXXXXXXXXNGSSNAVNLTDGLDGLAIVPVVLV
PF00953         AALILLLVLYGVI---GLTSLPVPFGGGL-IDLGWWLYIPLTLLVIVGTSNAVNLTDGLDGLAAGQSAII


                         .         .         .         +         .         .         .:280
query           AAGLGIYAYIETNSTLANYLLFNYLGNPGLAEVAVFCAAVCGSGLAFLWFNSHPAEVFMGDVGSLTLGAV
PF00953         AAALAIIAYI-----------------PGAGELAIFCLALVGACLGFLWYNAYPAKVFMGDTGSLFLGGA


                         .         *         .         .         .         .         +:350
query           LGVIAVMVRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00953         LAVVAILGR-------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxx
PF00953         ---------------