[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31313.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
   81::161     1e-07  34%  165 aa  PF00534 Glycos_transf_1 "Glycosyl transferases group 1"
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSEYLPVLDLYLSTSKVEGF
PF00534         ---------------------------------------------------AELYAAADVFVLPSRYEGF


                         .         *         .         .         .         .         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMRExxxxxxxx
PF00534         GLVLLEAMACGLPVIASDVGGLPEIVEDGETGFLVDPGDPELAEAILRLLEDP-ELRERMGE--------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxx
PF00534         ----------------